Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4KGI7

Protein Details
Accession W4KGI7    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MRCVPCNKTFRRKYDRRRHVVTVHHydrophilic
71-93AWLTGPCRSSRRRRGRAGSSTMAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 9, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
KEGG hir:HETIRDRAFT_473537  -  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MRCVPCNKTFRRKYDRRRHVVTVHYLGKIPCDWCDLFFYARRDGVTRHKDENCPARDFEDRHTNPRRWFMAWLTGPCRSSRRRRGRAGSSTMAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.91
3 0.88
4 0.87
5 0.84
6 0.79
7 0.76
8 0.72
9 0.68
10 0.61
11 0.53
12 0.47
13 0.4
14 0.36
15 0.3
16 0.23
17 0.17
18 0.17
19 0.16
20 0.16
21 0.19
22 0.18
23 0.18
24 0.22
25 0.23
26 0.21
27 0.22
28 0.21
29 0.19
30 0.21
31 0.28
32 0.3
33 0.31
34 0.35
35 0.37
36 0.38
37 0.42
38 0.48
39 0.43
40 0.38
41 0.35
42 0.33
43 0.35
44 0.34
45 0.34
46 0.36
47 0.34
48 0.4
49 0.47
50 0.49
51 0.48
52 0.54
53 0.52
54 0.42
55 0.44
56 0.38
57 0.41
58 0.4
59 0.41
60 0.38
61 0.39
62 0.38
63 0.38
64 0.41
65 0.4
66 0.46
67 0.53
68 0.6
69 0.66
70 0.75
71 0.82
72 0.86
73 0.87
74 0.84