Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JQV5

Protein Details
Accession W4JQV5   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
54-81HAPRTTTHPPKNSPRRPHKTTPSSVRPSHydrophilic
204-231IKDGNRRPPRLCRPPPPRARPDRTQYVRBasic
NLS Segment(s)
PositionSequence
144-187APRRSRPRTSPHDPRVLGRPIYRTRLERASAAPMPARARGPRAR
Subcellular Location(s) mito_nucl 11.166, nucl 11, mito 11
Family & Domain DBs
KEGG hir:HETIRDRAFT_107974  -  
Amino Acid Sequences MDRSCIIRRHPAPNNPPATPTVVSYSTLPAQLTQSPPDPPPGSTKHRRTCTDAHAPRTTTHPPKNSPRRPHKTTPSSVRPSVRPYYPRTASKVQSPASTTPRARAQPASRRRDPTALRAPVPLLLPRPVPVPVPVLRHTFSRAAPRRSRPRTSPHDPRVLGRPIYRTRLERASAAPMPARARGPRARTSTGHASSPQESRTAIIKDGNRRPPRLCRPPPPRARPDRTQYVRASRALVDPDPDLDLDPDIYTYIYIHMRIHTQRLRVPYPRPAATGSASQVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.66
3 0.63
4 0.55
5 0.51
6 0.42
7 0.36
8 0.31
9 0.26
10 0.26
11 0.25
12 0.26
13 0.23
14 0.23
15 0.22
16 0.18
17 0.19
18 0.22
19 0.24
20 0.23
21 0.24
22 0.26
23 0.26
24 0.33
25 0.31
26 0.28
27 0.32
28 0.36
29 0.42
30 0.49
31 0.58
32 0.61
33 0.68
34 0.7
35 0.7
36 0.7
37 0.7
38 0.71
39 0.68
40 0.65
41 0.63
42 0.6
43 0.54
44 0.53
45 0.53
46 0.51
47 0.52
48 0.52
49 0.54
50 0.64
51 0.74
52 0.78
53 0.8
54 0.82
55 0.83
56 0.84
57 0.87
58 0.86
59 0.84
60 0.84
61 0.83
62 0.81
63 0.79
64 0.76
65 0.71
66 0.63
67 0.6
68 0.56
69 0.53
70 0.48
71 0.47
72 0.5
73 0.52
74 0.53
75 0.53
76 0.54
77 0.5
78 0.52
79 0.52
80 0.45
81 0.41
82 0.41
83 0.39
84 0.38
85 0.43
86 0.36
87 0.33
88 0.38
89 0.37
90 0.36
91 0.37
92 0.4
93 0.44
94 0.53
95 0.58
96 0.58
97 0.61
98 0.61
99 0.62
100 0.56
101 0.55
102 0.55
103 0.5
104 0.45
105 0.41
106 0.39
107 0.33
108 0.32
109 0.24
110 0.16
111 0.14
112 0.13
113 0.13
114 0.14
115 0.12
116 0.12
117 0.12
118 0.14
119 0.15
120 0.19
121 0.21
122 0.23
123 0.23
124 0.23
125 0.25
126 0.23
127 0.22
128 0.29
129 0.33
130 0.37
131 0.43
132 0.51
133 0.58
134 0.63
135 0.66
136 0.61
137 0.63
138 0.65
139 0.67
140 0.69
141 0.65
142 0.67
143 0.62
144 0.59
145 0.57
146 0.52
147 0.45
148 0.37
149 0.38
150 0.33
151 0.37
152 0.38
153 0.34
154 0.34
155 0.37
156 0.36
157 0.31
158 0.29
159 0.3
160 0.28
161 0.27
162 0.24
163 0.22
164 0.22
165 0.22
166 0.23
167 0.18
168 0.23
169 0.27
170 0.32
171 0.37
172 0.41
173 0.44
174 0.43
175 0.48
176 0.51
177 0.47
178 0.43
179 0.38
180 0.35
181 0.34
182 0.35
183 0.29
184 0.21
185 0.2
186 0.19
187 0.22
188 0.2
189 0.18
190 0.21
191 0.26
192 0.34
193 0.42
194 0.51
195 0.52
196 0.55
197 0.58
198 0.63
199 0.69
200 0.71
201 0.71
202 0.71
203 0.75
204 0.82
205 0.88
206 0.87
207 0.87
208 0.86
209 0.85
210 0.83
211 0.82
212 0.82
213 0.77
214 0.75
215 0.71
216 0.7
217 0.67
218 0.6
219 0.54
220 0.45
221 0.43
222 0.39
223 0.34
224 0.27
225 0.23
226 0.22
227 0.21
228 0.19
229 0.16
230 0.13
231 0.12
232 0.11
233 0.1
234 0.09
235 0.09
236 0.08
237 0.08
238 0.07
239 0.1
240 0.11
241 0.12
242 0.13
243 0.14
244 0.21
245 0.24
246 0.33
247 0.35
248 0.38
249 0.42
250 0.48
251 0.54
252 0.54
253 0.57
254 0.57
255 0.61
256 0.59
257 0.56
258 0.52
259 0.48
260 0.44
261 0.43