Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JVI0

Protein Details
Accession W4JVI0   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-40HVERRAARRHCLLRRRCRSRFRQRRAPHVSABasic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 12.833, nucl 9, cyto_nucl 5.833
Family & Domain DBs
KEGG hir:HETIRDRAFT_327212  -  
Amino Acid Sequences MQTSSTPTTHVERRAARRHCLLRRRCRSRFRQRRAPHVSAYMPRLAHPKARMCTRPCPSCRRSPNRTGRCVSIPHIRCISLSFNRTRSVLWRTREGRTERVHPGVRKWAIVRVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.63
4 0.67
5 0.71
6 0.73
7 0.74
8 0.76
9 0.77
10 0.83
11 0.86
12 0.86
13 0.87
14 0.88
15 0.9
16 0.9
17 0.89
18 0.89
19 0.85
20 0.87
21 0.86
22 0.8
23 0.71
24 0.65
25 0.59
26 0.52
27 0.49
28 0.41
29 0.32
30 0.29
31 0.29
32 0.26
33 0.26
34 0.26
35 0.3
36 0.31
37 0.36
38 0.41
39 0.42
40 0.49
41 0.52
42 0.55
43 0.53
44 0.57
45 0.55
46 0.59
47 0.64
48 0.64
49 0.64
50 0.67
51 0.74
52 0.73
53 0.76
54 0.69
55 0.62
56 0.57
57 0.53
58 0.46
59 0.45
60 0.39
61 0.37
62 0.36
63 0.33
64 0.3
65 0.3
66 0.32
67 0.28
68 0.3
69 0.3
70 0.31
71 0.33
72 0.33
73 0.32
74 0.31
75 0.33
76 0.36
77 0.35
78 0.43
79 0.45
80 0.49
81 0.56
82 0.56
83 0.56
84 0.54
85 0.57
86 0.54
87 0.59
88 0.61
89 0.56
90 0.57
91 0.59
92 0.56
93 0.54
94 0.49