Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JTK1

Protein Details
Accession W4JTK1   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
42-63SRSESWRRRAPPQRVNEAKRIKHydrophilic
NLS Segment(s)
PositionSequence
48-83RRRAPPQRVNEAKRIKAPRRAALDRSIRAHRRARRA
206-224PRAAGREPRAALRWGKHRA
Subcellular Location(s) mito 11, nucl 10, cyto 5
Family & Domain DBs
KEGG hir:HETIRDRAFT_430140  -  
Amino Acid Sequences MLRDWMIGTRPPPSPLSSWRRATPHSIDMIRVVQKRASTVTSRSESWRRRAPPQRVNEAKRIKAPRRAALDRSIRAHRRARRASGDGGGGGDGGGDGDGGESVFACWWRVKQAASASSALRARRLRVQRHSAPMRRGAPDSSTRRLATQGLGARRRACVRACGQDGSDSRFAIRDSWVELCGDGAGRASPATRTAHTAHPTNGREPRAAGREPRAALRWGKHRAGTEPGGSEEGKRELRSHGASLFLRAGVSVALAAWAVDGRCGGLEACGPGSLEAKLPLTPGRMGYWGRAVCHPDDTAWAWAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.39
3 0.46
4 0.5
5 0.53
6 0.56
7 0.59
8 0.58
9 0.61
10 0.57
11 0.54
12 0.53
13 0.49
14 0.44
15 0.42
16 0.44
17 0.44
18 0.41
19 0.37
20 0.32
21 0.31
22 0.33
23 0.33
24 0.31
25 0.28
26 0.3
27 0.35
28 0.36
29 0.37
30 0.42
31 0.49
32 0.51
33 0.55
34 0.6
35 0.56
36 0.63
37 0.71
38 0.75
39 0.74
40 0.76
41 0.79
42 0.8
43 0.81
44 0.8
45 0.78
46 0.72
47 0.72
48 0.73
49 0.69
50 0.68
51 0.69
52 0.67
53 0.68
54 0.69
55 0.64
56 0.63
57 0.65
58 0.6
59 0.58
60 0.6
61 0.56
62 0.57
63 0.62
64 0.6
65 0.62
66 0.65
67 0.66
68 0.65
69 0.64
70 0.61
71 0.55
72 0.48
73 0.38
74 0.31
75 0.24
76 0.16
77 0.12
78 0.08
79 0.05
80 0.03
81 0.03
82 0.02
83 0.02
84 0.02
85 0.02
86 0.02
87 0.02
88 0.02
89 0.03
90 0.04
91 0.04
92 0.05
93 0.06
94 0.07
95 0.1
96 0.12
97 0.13
98 0.16
99 0.21
100 0.22
101 0.24
102 0.26
103 0.23
104 0.25
105 0.27
106 0.23
107 0.24
108 0.23
109 0.22
110 0.29
111 0.37
112 0.41
113 0.46
114 0.54
115 0.54
116 0.62
117 0.69
118 0.66
119 0.62
120 0.61
121 0.57
122 0.5
123 0.46
124 0.37
125 0.32
126 0.35
127 0.37
128 0.33
129 0.33
130 0.31
131 0.3
132 0.31
133 0.28
134 0.2
135 0.2
136 0.2
137 0.23
138 0.25
139 0.26
140 0.26
141 0.27
142 0.28
143 0.26
144 0.23
145 0.22
146 0.23
147 0.28
148 0.29
149 0.29
150 0.27
151 0.3
152 0.3
153 0.29
154 0.27
155 0.2
156 0.18
157 0.18
158 0.18
159 0.14
160 0.14
161 0.1
162 0.1
163 0.11
164 0.12
165 0.11
166 0.1
167 0.09
168 0.08
169 0.08
170 0.05
171 0.04
172 0.04
173 0.04
174 0.04
175 0.05
176 0.05
177 0.08
178 0.1
179 0.11
180 0.14
181 0.17
182 0.23
183 0.26
184 0.28
185 0.28
186 0.34
187 0.36
188 0.38
189 0.41
190 0.37
191 0.35
192 0.34
193 0.37
194 0.34
195 0.35
196 0.33
197 0.33
198 0.36
199 0.36
200 0.37
201 0.34
202 0.33
203 0.34
204 0.36
205 0.39
206 0.4
207 0.42
208 0.43
209 0.42
210 0.42
211 0.44
212 0.41
213 0.35
214 0.29
215 0.28
216 0.27
217 0.25
218 0.22
219 0.19
220 0.21
221 0.21
222 0.21
223 0.21
224 0.21
225 0.27
226 0.29
227 0.28
228 0.24
229 0.27
230 0.27
231 0.28
232 0.26
233 0.21
234 0.18
235 0.15
236 0.14
237 0.08
238 0.08
239 0.05
240 0.04
241 0.04
242 0.04
243 0.04
244 0.04
245 0.05
246 0.05
247 0.05
248 0.05
249 0.05
250 0.05
251 0.06
252 0.06
253 0.06
254 0.08
255 0.09
256 0.09
257 0.1
258 0.1
259 0.1
260 0.12
261 0.11
262 0.12
263 0.12
264 0.13
265 0.13
266 0.14
267 0.16
268 0.18
269 0.19
270 0.19
271 0.19
272 0.23
273 0.24
274 0.25
275 0.31
276 0.3
277 0.31
278 0.34
279 0.36
280 0.33
281 0.35
282 0.33
283 0.26
284 0.28
285 0.28