Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4KGI5

Protein Details
Accession W4KGI5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
75-95GTAKDKSRKSRGTTGHRGRGLBasic
NLS Segment(s)
PositionSequence
82-85RKSR
Subcellular Location(s) cyto 9, mito 8, extr 8
Family & Domain DBs
KEGG hir:HETIRDRAFT_244021  -  
Amino Acid Sequences CAEPCHPSTCPPCAVTEAALCWCGTTTRNVPCSANGGAALAPEIPCDRPCGARARAVRHQCTRVCYPLAALAGMGTAKDKSRKSRGTTGHRGRGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.24
4 0.21
5 0.18
6 0.18
7 0.16
8 0.13
9 0.12
10 0.11
11 0.1
12 0.14
13 0.18
14 0.24
15 0.27
16 0.28
17 0.29
18 0.28
19 0.31
20 0.27
21 0.22
22 0.15
23 0.13
24 0.11
25 0.1
26 0.1
27 0.06
28 0.05
29 0.05
30 0.06
31 0.06
32 0.06
33 0.09
34 0.1
35 0.1
36 0.12
37 0.18
38 0.19
39 0.25
40 0.28
41 0.33
42 0.4
43 0.46
44 0.51
45 0.49
46 0.54
47 0.5
48 0.52
49 0.49
50 0.45
51 0.4
52 0.33
53 0.29
54 0.26
55 0.24
56 0.19
57 0.15
58 0.1
59 0.09
60 0.09
61 0.08
62 0.05
63 0.06
64 0.09
65 0.16
66 0.2
67 0.28
68 0.38
69 0.46
70 0.52
71 0.61
72 0.68
73 0.72
74 0.79
75 0.81