Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4KIU4

Protein Details
Accession W4KIU4    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
105-128KGEKKVKAPKSPKKEKINPAKVGRBasic
NLS Segment(s)
PositionSequence
81-145KKEDRPKSPSLLAKLLAPFKNEKAKGEKKVKAPKSPKKEKINPAKVGRRLSARVGEFFKPKPKAE
Subcellular Location(s) cyto 15.5, cyto_nucl 11.833, nucl 7, mito_nucl 5.833, mito 3.5
Family & Domain DBs
KEGG hir:HETIRDRAFT_407664  -  
Amino Acid Sequences MSAPAETVAPVAAPVEEVAPVEVPSETAPTVEAPKAEEVADAPKAEAASEEPATAPAAETSEAAAEPAKEDETKPAEGEAKKEDRPKSPSLLAKLLAPFKNEKAKGEKKVKAPKSPKKEKINPAKVGRRLSARVGEFFKPKPKAEHPIPAKVDENPPKIDEPEPVAPLENPASEAPAAEEVATPAAEAASAPAVEEPKPEAPAATPVVAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.07
6 0.08
7 0.08
8 0.08
9 0.08
10 0.08
11 0.08
12 0.1
13 0.09
14 0.08
15 0.09
16 0.1
17 0.13
18 0.14
19 0.13
20 0.13
21 0.15
22 0.16
23 0.15
24 0.14
25 0.12
26 0.14
27 0.16
28 0.14
29 0.13
30 0.13
31 0.13
32 0.12
33 0.12
34 0.1
35 0.12
36 0.12
37 0.12
38 0.11
39 0.12
40 0.12
41 0.12
42 0.1
43 0.06
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.06
53 0.06
54 0.07
55 0.08
56 0.08
57 0.08
58 0.13
59 0.16
60 0.17
61 0.16
62 0.17
63 0.21
64 0.21
65 0.23
66 0.24
67 0.25
68 0.28
69 0.35
70 0.37
71 0.37
72 0.42
73 0.43
74 0.41
75 0.42
76 0.43
77 0.4
78 0.39
79 0.33
80 0.3
81 0.3
82 0.31
83 0.26
84 0.24
85 0.22
86 0.22
87 0.3
88 0.28
89 0.28
90 0.31
91 0.37
92 0.44
93 0.51
94 0.53
95 0.54
96 0.63
97 0.67
98 0.68
99 0.72
100 0.72
101 0.74
102 0.79
103 0.8
104 0.8
105 0.84
106 0.83
107 0.84
108 0.84
109 0.82
110 0.8
111 0.78
112 0.74
113 0.68
114 0.61
115 0.54
116 0.47
117 0.42
118 0.4
119 0.33
120 0.31
121 0.31
122 0.32
123 0.31
124 0.32
125 0.37
126 0.35
127 0.35
128 0.38
129 0.4
130 0.45
131 0.46
132 0.54
133 0.51
134 0.55
135 0.56
136 0.52
137 0.49
138 0.43
139 0.47
140 0.45
141 0.44
142 0.37
143 0.37
144 0.35
145 0.36
146 0.35
147 0.28
148 0.26
149 0.26
150 0.25
151 0.24
152 0.23
153 0.21
154 0.22
155 0.22
156 0.16
157 0.14
158 0.13
159 0.14
160 0.13
161 0.13
162 0.11
163 0.11
164 0.11
165 0.09
166 0.1
167 0.08
168 0.09
169 0.09
170 0.07
171 0.06
172 0.06
173 0.05
174 0.05
175 0.05
176 0.06
177 0.06
178 0.06
179 0.08
180 0.1
181 0.1
182 0.12
183 0.15
184 0.17
185 0.19
186 0.19
187 0.18
188 0.18
189 0.23
190 0.25
191 0.21
192 0.18