Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JVS6

Protein Details
Accession W4JVS6    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
49-71ASTTARRPRSREQPRPPHPRLLTHydrophilic
NLS Segment(s)
PositionSequence
54-68RRPRSREQPRPPHPR
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
KEGG hir:HETIRDRAFT_481087  -  
Amino Acid Sequences MLPPPPPGSTTPRPCPVPTTVPGSTTPPPCPIPTTPPPPPCRLHRRSLASTTARRPRSREQPRPPHPRLLTRRRLLTFSSTSPAPRQQRCLLETTALTTTPKPPRCGLHARSQRPQVCSRLLEPGSSSRCGLHAVSTRQVPTTSPPGPCLPVHTAEIVNGEASRALPPRQHGVAAFPSPPSPRFQRWLPEDAALPGVSSCTTAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.58
3 0.55
4 0.52
5 0.47
6 0.46
7 0.4
8 0.39
9 0.39
10 0.4
11 0.39
12 0.37
13 0.36
14 0.33
15 0.34
16 0.33
17 0.36
18 0.34
19 0.36
20 0.4
21 0.46
22 0.5
23 0.56
24 0.6
25 0.61
26 0.62
27 0.63
28 0.66
29 0.63
30 0.62
31 0.62
32 0.66
33 0.66
34 0.66
35 0.65
36 0.62
37 0.62
38 0.63
39 0.63
40 0.62
41 0.59
42 0.6
43 0.6
44 0.64
45 0.69
46 0.71
47 0.73
48 0.77
49 0.85
50 0.89
51 0.85
52 0.83
53 0.76
54 0.75
55 0.74
56 0.73
57 0.73
58 0.67
59 0.71
60 0.63
61 0.61
62 0.53
63 0.49
64 0.42
65 0.34
66 0.31
67 0.25
68 0.25
69 0.25
70 0.31
71 0.32
72 0.31
73 0.34
74 0.37
75 0.41
76 0.41
77 0.42
78 0.35
79 0.29
80 0.27
81 0.24
82 0.19
83 0.15
84 0.14
85 0.11
86 0.16
87 0.23
88 0.26
89 0.26
90 0.27
91 0.29
92 0.34
93 0.42
94 0.39
95 0.42
96 0.48
97 0.51
98 0.54
99 0.61
100 0.59
101 0.55
102 0.55
103 0.49
104 0.43
105 0.4
106 0.35
107 0.35
108 0.31
109 0.27
110 0.25
111 0.27
112 0.26
113 0.25
114 0.24
115 0.17
116 0.17
117 0.18
118 0.17
119 0.16
120 0.19
121 0.21
122 0.24
123 0.25
124 0.26
125 0.25
126 0.25
127 0.21
128 0.19
129 0.23
130 0.24
131 0.23
132 0.25
133 0.26
134 0.29
135 0.28
136 0.29
137 0.25
138 0.24
139 0.24
140 0.23
141 0.21
142 0.19
143 0.21
144 0.16
145 0.13
146 0.1
147 0.09
148 0.07
149 0.08
150 0.1
151 0.11
152 0.13
153 0.15
154 0.18
155 0.24
156 0.25
157 0.25
158 0.23
159 0.25
160 0.3
161 0.3
162 0.28
163 0.23
164 0.25
165 0.26
166 0.27
167 0.28
168 0.29
169 0.32
170 0.36
171 0.4
172 0.46
173 0.49
174 0.54
175 0.51
176 0.47
177 0.43
178 0.39
179 0.37
180 0.27
181 0.22
182 0.16
183 0.14
184 0.11
185 0.11