Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4KE69

Protein Details
Accession W4KE69    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
234-255AWAWARYVLRRSRRRSRAPGEGHydrophilic
NLS Segment(s)
PositionSequence
243-252RRSRRRSRAP
Subcellular Location(s) mito 16, extr 8, nucl 1, cyto 1, plas 1, cyto_nucl 1
Family & Domain DBs
KEGG hir:HETIRDRAFT_472558  -  
Amino Acid Sequences MPATAMIIAAVRRIRRRHLSPPTIPASPRRARFDRAVRVPPVPSLSRLSEAVRPSVLDRAGVDRLSLRARPLSSAGLCQIAARARVSAGGGRQCQCQCVSASASVSASARARAWHARLTDARAPHRGAGEWAGASIGWPWCGDKWARCIAAAAAAATSAAGWGRAGDLRGAAGLPTASGAPASQGGSDTSSLRSERPFLPLHTIGRLFRIRRTGARRSAWVAQRQRQTRRQGWAWAWARYVLRRSRRRSRAPGEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.48
3 0.55
4 0.62
5 0.69
6 0.73
7 0.72
8 0.76
9 0.73
10 0.68
11 0.63
12 0.59
13 0.57
14 0.55
15 0.56
16 0.56
17 0.55
18 0.56
19 0.63
20 0.66
21 0.67
22 0.68
23 0.68
24 0.63
25 0.62
26 0.58
27 0.51
28 0.47
29 0.38
30 0.33
31 0.3
32 0.29
33 0.28
34 0.29
35 0.29
36 0.28
37 0.28
38 0.27
39 0.23
40 0.22
41 0.2
42 0.23
43 0.2
44 0.16
45 0.15
46 0.17
47 0.19
48 0.18
49 0.17
50 0.14
51 0.16
52 0.19
53 0.19
54 0.16
55 0.18
56 0.19
57 0.2
58 0.21
59 0.23
60 0.2
61 0.21
62 0.2
63 0.17
64 0.17
65 0.15
66 0.15
67 0.13
68 0.13
69 0.12
70 0.11
71 0.1
72 0.11
73 0.11
74 0.11
75 0.12
76 0.16
77 0.19
78 0.2
79 0.25
80 0.25
81 0.26
82 0.25
83 0.23
84 0.19
85 0.18
86 0.19
87 0.15
88 0.15
89 0.14
90 0.14
91 0.12
92 0.11
93 0.11
94 0.09
95 0.09
96 0.09
97 0.09
98 0.11
99 0.14
100 0.15
101 0.18
102 0.18
103 0.21
104 0.22
105 0.27
106 0.28
107 0.28
108 0.29
109 0.28
110 0.28
111 0.25
112 0.25
113 0.2
114 0.17
115 0.15
116 0.13
117 0.09
118 0.08
119 0.07
120 0.06
121 0.06
122 0.07
123 0.05
124 0.05
125 0.05
126 0.06
127 0.06
128 0.08
129 0.1
130 0.1
131 0.15
132 0.19
133 0.19
134 0.19
135 0.2
136 0.18
137 0.19
138 0.17
139 0.13
140 0.08
141 0.07
142 0.07
143 0.06
144 0.06
145 0.03
146 0.02
147 0.02
148 0.03
149 0.03
150 0.04
151 0.05
152 0.05
153 0.06
154 0.06
155 0.06
156 0.06
157 0.06
158 0.05
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.06
169 0.06
170 0.06
171 0.07
172 0.07
173 0.09
174 0.1
175 0.1
176 0.11
177 0.13
178 0.14
179 0.14
180 0.15
181 0.18
182 0.18
183 0.22
184 0.23
185 0.23
186 0.29
187 0.32
188 0.33
189 0.33
190 0.35
191 0.3
192 0.34
193 0.39
194 0.33
195 0.33
196 0.38
197 0.37
198 0.43
199 0.5
200 0.53
201 0.56
202 0.59
203 0.59
204 0.57
205 0.62
206 0.61
207 0.63
208 0.63
209 0.62
210 0.67
211 0.71
212 0.75
213 0.75
214 0.77
215 0.75
216 0.75
217 0.72
218 0.72
219 0.66
220 0.67
221 0.64
222 0.57
223 0.52
224 0.47
225 0.46
226 0.42
227 0.47
228 0.46
229 0.51
230 0.58
231 0.65
232 0.72
233 0.79
234 0.84
235 0.86