Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4JXD6

Protein Details
Accession W4JXD6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-23ADDRRHCKAHHQSRRISTTLHydrophilic
NLS Segment(s)
PositionSequence
104-109RRRRRS
Subcellular Location(s) plas 9, mito 4, extr 4, golg 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG hir:HETIRDRAFT_163718  -  
Amino Acid Sequences MSGADDRRHCKAHHQSRRISTTLLPPVYSSCWLHHGLDALLLSLIPYSPSRPCCFAAPLFILSCYCDGLRPSGSFSFTCSTFLHGLFMFLFFLPLSPFLSFTRRRRRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.7
3 0.76
4 0.81
5 0.72
6 0.63
7 0.55
8 0.52
9 0.52
10 0.44
11 0.35
12 0.3
13 0.3
14 0.3
15 0.3
16 0.23
17 0.16
18 0.19
19 0.21
20 0.21
21 0.2
22 0.19
23 0.16
24 0.16
25 0.14
26 0.1
27 0.08
28 0.07
29 0.06
30 0.04
31 0.04
32 0.04
33 0.04
34 0.06
35 0.1
36 0.13
37 0.14
38 0.17
39 0.19
40 0.19
41 0.21
42 0.2
43 0.2
44 0.18
45 0.18
46 0.15
47 0.14
48 0.13
49 0.11
50 0.11
51 0.09
52 0.08
53 0.07
54 0.08
55 0.1
56 0.12
57 0.12
58 0.15
59 0.15
60 0.18
61 0.16
62 0.19
63 0.19
64 0.17
65 0.2
66 0.17
67 0.19
68 0.18
69 0.19
70 0.18
71 0.15
72 0.16
73 0.13
74 0.14
75 0.11
76 0.09
77 0.1
78 0.07
79 0.08
80 0.08
81 0.08
82 0.1
83 0.1
84 0.12
85 0.14
86 0.22
87 0.3
88 0.39
89 0.49