Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4KEZ5

Protein Details
Accession W4KEZ5    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-36APPPSSGGKSAKKKKWSKGKVKDKAQHAVMHydrophilic
NLS Segment(s)
PositionSequence
4-30AKAAPPPSSGGKSAKKKKWSKGKVKDK
Subcellular Location(s) nucl 13, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG hir:HETIRDRAFT_473013  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAPPPSSGGKSAKKKKWSKGKVKDKAQHAVMIDKPTYDRILKEVPTFRLISQSILIERLKVNGSLARVAIRHLEKEGTIKRIVHHHGQLIYTRSTASSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.53
3 0.61
4 0.63
5 0.68
6 0.74
7 0.8
8 0.84
9 0.85
10 0.86
11 0.87
12 0.9
13 0.9
14 0.91
15 0.89
16 0.84
17 0.8
18 0.71
19 0.63
20 0.53
21 0.47
22 0.4
23 0.35
24 0.29
25 0.22
26 0.21
27 0.19
28 0.2
29 0.16
30 0.14
31 0.14
32 0.17
33 0.18
34 0.22
35 0.24
36 0.23
37 0.25
38 0.26
39 0.22
40 0.23
41 0.22
42 0.19
43 0.16
44 0.15
45 0.13
46 0.15
47 0.14
48 0.11
49 0.11
50 0.12
51 0.12
52 0.11
53 0.12
54 0.11
55 0.12
56 0.12
57 0.13
58 0.13
59 0.12
60 0.13
61 0.17
62 0.17
63 0.17
64 0.17
65 0.18
66 0.17
67 0.25
68 0.28
69 0.26
70 0.28
71 0.28
72 0.29
73 0.36
74 0.4
75 0.39
76 0.39
77 0.4
78 0.4
79 0.4
80 0.43
81 0.39
82 0.36
83 0.29
84 0.26