Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4KMK1

Protein Details
Accession W4KMK1    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
55-80VTASPEKFLRNRRRERREPPPPPPENHydrophilic
NLS Segment(s)
PositionSequence
64-74RNRRRERREPP
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
KEGG hir:HETIRDRAFT_447654  -  
Amino Acid Sequences MSSCQQFRVRFPAELEKPPADRPRKANLTYPKVAQVKHSKDRIESADLYWGHRCVTASPEKFLRNRRRERREPPPPPPENDSKAGLLRSLSNALATDGPPIGLRQSPRPQLAISVPDKNSERAVHPLRLKSAPPLSITPTSTSSSSSGDQDSNYSYLDVKETKDEQHHGPLLSEVRPVTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.54
3 0.49
4 0.48
5 0.52
6 0.57
7 0.53
8 0.54
9 0.53
10 0.58
11 0.62
12 0.62
13 0.64
14 0.65
15 0.66
16 0.64
17 0.6
18 0.58
19 0.54
20 0.51
21 0.5
22 0.5
23 0.51
24 0.55
25 0.59
26 0.52
27 0.51
28 0.55
29 0.51
30 0.47
31 0.39
32 0.32
33 0.33
34 0.31
35 0.32
36 0.28
37 0.25
38 0.2
39 0.2
40 0.19
41 0.13
42 0.18
43 0.24
44 0.24
45 0.27
46 0.3
47 0.33
48 0.38
49 0.46
50 0.52
51 0.53
52 0.62
53 0.7
54 0.76
55 0.81
56 0.85
57 0.86
58 0.86
59 0.84
60 0.83
61 0.82
62 0.76
63 0.7
64 0.67
65 0.61
66 0.54
67 0.48
68 0.41
69 0.32
70 0.3
71 0.26
72 0.22
73 0.16
74 0.13
75 0.11
76 0.11
77 0.09
78 0.08
79 0.08
80 0.08
81 0.08
82 0.08
83 0.07
84 0.06
85 0.06
86 0.06
87 0.06
88 0.07
89 0.08
90 0.09
91 0.15
92 0.22
93 0.26
94 0.28
95 0.29
96 0.28
97 0.28
98 0.29
99 0.29
100 0.25
101 0.27
102 0.26
103 0.28
104 0.3
105 0.28
106 0.29
107 0.24
108 0.23
109 0.26
110 0.3
111 0.32
112 0.35
113 0.37
114 0.38
115 0.39
116 0.38
117 0.36
118 0.36
119 0.31
120 0.3
121 0.29
122 0.3
123 0.31
124 0.32
125 0.28
126 0.27
127 0.27
128 0.25
129 0.24
130 0.21
131 0.21
132 0.21
133 0.2
134 0.19
135 0.18
136 0.18
137 0.18
138 0.19
139 0.17
140 0.16
141 0.14
142 0.13
143 0.13
144 0.16
145 0.16
146 0.16
147 0.21
148 0.22
149 0.26
150 0.31
151 0.35
152 0.34
153 0.41
154 0.43
155 0.38
156 0.37
157 0.36
158 0.34
159 0.31
160 0.3