Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4KJB2

Protein Details
Accession W4KJB2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
51-82RATSRHEKKGEKRRRLRSQRWRRRFAHEVRKKBasic
NLS Segment(s)
PositionSequence
54-82SRHEKKGEKRRRLRSQRWRRRFAHEVRKK
Subcellular Location(s) mito 14, nucl 6, cyto 4, extr 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG hir:HETIRDRAFT_311623  -  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MRVRSITLSILVVLTSAHLGRSVEVRNGNVGEALAQLQTILQRNRVQAEIRATSRHEKKGEKRRRLRSQRWRRRFAHEVRKKVQLVNEIRARGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.07
6 0.07
7 0.08
8 0.12
9 0.13
10 0.16
11 0.18
12 0.19
13 0.2
14 0.2
15 0.19
16 0.15
17 0.13
18 0.1
19 0.08
20 0.08
21 0.05
22 0.05
23 0.04
24 0.04
25 0.07
26 0.11
27 0.11
28 0.14
29 0.17
30 0.18
31 0.2
32 0.22
33 0.2
34 0.19
35 0.23
36 0.22
37 0.21
38 0.22
39 0.23
40 0.29
41 0.33
42 0.36
43 0.36
44 0.4
45 0.49
46 0.59
47 0.67
48 0.7
49 0.75
50 0.8
51 0.87
52 0.9
53 0.91
54 0.92
55 0.93
56 0.93
57 0.94
58 0.92
59 0.85
60 0.83
61 0.82
62 0.81
63 0.81
64 0.79
65 0.79
66 0.74
67 0.78
68 0.71
69 0.65
70 0.6
71 0.59
72 0.55
73 0.55
74 0.57