Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JQV1

Protein Details
Accession W4JQV1    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
124-148RRDARVSKSRRRAHRAYKPRTGLRABasic
NLS Segment(s)
PositionSequence
103-107RRRRP
114-143RTRNASRGEARRDARVSKSRRRAHRAYKPR
Subcellular Location(s) mito 15, cyto 6, nucl 5
Family & Domain DBs
KEGG hir:HETIRDRAFT_430387  -  
Amino Acid Sequences MTRSSARFPPEAKQHRSRDNITWTCAMHARRSSDYGMLEGPRILQRWRDVGEGTGHATVKPSHGQAPGQRRGIGGRLGPVVFYTTCCAVLYCRSGDACAAMRRRRRPVGYSWYRTRNASRGEARRDARVSKSRRRAHRAYKPRTGLRASCTVAFPCSARRRRALAALCCAWTASDGLLYLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.71
3 0.76
4 0.73
5 0.7
6 0.71
7 0.67
8 0.61
9 0.57
10 0.48
11 0.44
12 0.45
13 0.39
14 0.35
15 0.35
16 0.36
17 0.35
18 0.37
19 0.36
20 0.34
21 0.33
22 0.28
23 0.26
24 0.22
25 0.19
26 0.16
27 0.17
28 0.15
29 0.16
30 0.16
31 0.17
32 0.19
33 0.23
34 0.25
35 0.24
36 0.22
37 0.23
38 0.24
39 0.22
40 0.21
41 0.18
42 0.16
43 0.15
44 0.16
45 0.14
46 0.14
47 0.15
48 0.14
49 0.15
50 0.17
51 0.19
52 0.24
53 0.33
54 0.37
55 0.37
56 0.36
57 0.33
58 0.33
59 0.32
60 0.28
61 0.2
62 0.15
63 0.14
64 0.14
65 0.13
66 0.12
67 0.11
68 0.09
69 0.09
70 0.09
71 0.08
72 0.08
73 0.08
74 0.08
75 0.07
76 0.09
77 0.1
78 0.09
79 0.1
80 0.09
81 0.09
82 0.09
83 0.1
84 0.11
85 0.14
86 0.19
87 0.24
88 0.31
89 0.37
90 0.44
91 0.48
92 0.49
93 0.48
94 0.5
95 0.55
96 0.58
97 0.6
98 0.6
99 0.61
100 0.59
101 0.58
102 0.54
103 0.49
104 0.44
105 0.43
106 0.45
107 0.46
108 0.5
109 0.55
110 0.54
111 0.53
112 0.52
113 0.48
114 0.47
115 0.48
116 0.5
117 0.52
118 0.61
119 0.64
120 0.7
121 0.76
122 0.78
123 0.8
124 0.83
125 0.84
126 0.82
127 0.84
128 0.83
129 0.8
130 0.77
131 0.72
132 0.64
133 0.58
134 0.57
135 0.5
136 0.43
137 0.4
138 0.35
139 0.3
140 0.28
141 0.24
142 0.25
143 0.33
144 0.39
145 0.42
146 0.46
147 0.5
148 0.53
149 0.61
150 0.6
151 0.57
152 0.58
153 0.56
154 0.52
155 0.46
156 0.42
157 0.33
158 0.25
159 0.19
160 0.11
161 0.09