Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4KI12

Protein Details
Accession W4KI12    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
16-35FKTSGPRKKRTGKLVLQHTSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012942  SRR1-like  
IPR040044  SRR1L  
KEGG hir:HETIRDRAFT_448582  -  
Pfam View protein in Pfam  
PF07985  SRR1  
Amino Acid Sequences MAASVEQPAFRYADGFKTSGPRKKRTGKLVLQHTSSELYDSSLQELRTGNWLQECHRLTRDAVKEASIDSPSVLCLGLGCPASSRNARSQLAFLIETRDNLFLDRDKVAAYDPAFTAEDVALLAQLSSKDLSIETPTLLFMPHCDMGLYEALLRDNWSSERLCSLFLIGNLFSDYLVNKPSNKMATQFPCLTRLTPYLLARPLPSGGPNPTAFVSLAIQFVAPQALPPRTDTTFWELPSQSDVAGESNKGCFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.23
4 0.31
5 0.39
6 0.45
7 0.51
8 0.51
9 0.58
10 0.67
11 0.74
12 0.75
13 0.77
14 0.78
15 0.8
16 0.83
17 0.8
18 0.72
19 0.64
20 0.56
21 0.48
22 0.39
23 0.31
24 0.21
25 0.17
26 0.17
27 0.17
28 0.18
29 0.19
30 0.19
31 0.2
32 0.2
33 0.18
34 0.21
35 0.21
36 0.2
37 0.2
38 0.22
39 0.22
40 0.3
41 0.31
42 0.3
43 0.31
44 0.31
45 0.29
46 0.37
47 0.39
48 0.34
49 0.33
50 0.3
51 0.28
52 0.27
53 0.28
54 0.2
55 0.15
56 0.11
57 0.11
58 0.1
59 0.1
60 0.08
61 0.05
62 0.05
63 0.05
64 0.08
65 0.08
66 0.08
67 0.08
68 0.09
69 0.12
70 0.14
71 0.17
72 0.19
73 0.25
74 0.26
75 0.27
76 0.27
77 0.25
78 0.25
79 0.23
80 0.18
81 0.17
82 0.16
83 0.16
84 0.16
85 0.16
86 0.13
87 0.13
88 0.14
89 0.11
90 0.13
91 0.12
92 0.11
93 0.1
94 0.1
95 0.1
96 0.12
97 0.11
98 0.1
99 0.1
100 0.12
101 0.12
102 0.11
103 0.11
104 0.08
105 0.08
106 0.06
107 0.06
108 0.04
109 0.03
110 0.03
111 0.03
112 0.03
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.05
119 0.07
120 0.07
121 0.07
122 0.07
123 0.07
124 0.07
125 0.07
126 0.06
127 0.05
128 0.08
129 0.08
130 0.08
131 0.08
132 0.08
133 0.09
134 0.1
135 0.09
136 0.06
137 0.06
138 0.07
139 0.07
140 0.08
141 0.06
142 0.07
143 0.08
144 0.1
145 0.1
146 0.1
147 0.13
148 0.13
149 0.13
150 0.12
151 0.13
152 0.12
153 0.12
154 0.14
155 0.1
156 0.1
157 0.1
158 0.1
159 0.09
160 0.07
161 0.08
162 0.07
163 0.1
164 0.11
165 0.11
166 0.13
167 0.17
168 0.2
169 0.2
170 0.22
171 0.27
172 0.3
173 0.35
174 0.38
175 0.35
176 0.36
177 0.36
178 0.34
179 0.29
180 0.27
181 0.26
182 0.27
183 0.27
184 0.29
185 0.3
186 0.31
187 0.28
188 0.28
189 0.24
190 0.2
191 0.2
192 0.19
193 0.2
194 0.23
195 0.23
196 0.23
197 0.22
198 0.23
199 0.21
200 0.18
201 0.17
202 0.13
203 0.13
204 0.11
205 0.11
206 0.09
207 0.1
208 0.09
209 0.07
210 0.08
211 0.13
212 0.16
213 0.17
214 0.2
215 0.25
216 0.26
217 0.28
218 0.3
219 0.32
220 0.35
221 0.35
222 0.38
223 0.33
224 0.32
225 0.34
226 0.31
227 0.22
228 0.18
229 0.18
230 0.15
231 0.16
232 0.16
233 0.14