Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4K1Z2

Protein Details
Accession W4K1Z2   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
213-245FVEPVKRESKKERKEKKDREKRERKQKELEELABasic
NLS Segment(s)
PositionSequence
123-125KKR
137-154GPKSKKAKPATKVTKGRF
218-240KRESKKERKEKKDREKRERKQKE
Subcellular Location(s) nucl 13.5, cyto_nucl 12.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013243  SCA7_dom  
IPR037804  SGF73  
Gene Ontology GO:0000124  C:SAGA complex  
KEGG hir:HETIRDRAFT_453614  -  
Pfam View protein in Pfam  
PF08313  SCA7  
PROSITE View protein in PROSITE  
PS51505  SCA7  
Amino Acid Sequences MALRLKHSPSPAPFSFDNLPSTPPSLSPSTTVSNLPSPPTSWLSARDMKVFGADPLRSLNEIGLVKCKECGKPVLRSAAAEHAEHCRTIRLGKGAKGKADDSGELPALQLRPQSLNCLLVKGKKRKADDVDPADPDGPKSKKAKPATKVTKGRFKGPVDLDRQCGVINDKGLPCSRSLTCKSHSMGSKRALAGRSKAYDELLLEWRRANDPGFVEPVKRESKKERKEKKDREKRERKQKELEELAKKNGIDLSQPGAEARLEQIKATTKKKKTTTAIATTAAGGTGAGVTASARVAAVEEDPALESLAEVDSESELDSMVKSVRVAQERGVLGVPLAVPCDAGSWFVVRRERLRNCRDLFAGALMKGGVSSVAAAGAAARLGTGGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.41
4 0.41
5 0.33
6 0.35
7 0.31
8 0.33
9 0.28
10 0.23
11 0.25
12 0.24
13 0.24
14 0.24
15 0.25
16 0.27
17 0.28
18 0.29
19 0.27
20 0.29
21 0.29
22 0.3
23 0.27
24 0.25
25 0.27
26 0.29
27 0.29
28 0.26
29 0.29
30 0.32
31 0.38
32 0.39
33 0.38
34 0.36
35 0.33
36 0.34
37 0.3
38 0.25
39 0.24
40 0.22
41 0.19
42 0.21
43 0.23
44 0.21
45 0.2
46 0.18
47 0.18
48 0.2
49 0.19
50 0.24
51 0.23
52 0.23
53 0.26
54 0.3
55 0.26
56 0.28
57 0.36
58 0.34
59 0.4
60 0.45
61 0.5
62 0.47
63 0.46
64 0.45
65 0.44
66 0.41
67 0.33
68 0.29
69 0.27
70 0.27
71 0.26
72 0.24
73 0.19
74 0.18
75 0.19
76 0.22
77 0.24
78 0.27
79 0.33
80 0.42
81 0.42
82 0.45
83 0.46
84 0.42
85 0.38
86 0.36
87 0.31
88 0.23
89 0.22
90 0.2
91 0.17
92 0.16
93 0.15
94 0.13
95 0.13
96 0.12
97 0.11
98 0.14
99 0.15
100 0.19
101 0.18
102 0.23
103 0.22
104 0.24
105 0.25
106 0.29
107 0.38
108 0.42
109 0.47
110 0.49
111 0.52
112 0.57
113 0.62
114 0.63
115 0.64
116 0.62
117 0.6
118 0.55
119 0.52
120 0.45
121 0.38
122 0.31
123 0.29
124 0.22
125 0.23
126 0.27
127 0.32
128 0.4
129 0.49
130 0.56
131 0.55
132 0.65
133 0.7
134 0.75
135 0.78
136 0.75
137 0.76
138 0.69
139 0.68
140 0.65
141 0.57
142 0.54
143 0.5
144 0.51
145 0.47
146 0.48
147 0.44
148 0.37
149 0.36
150 0.28
151 0.24
152 0.19
153 0.15
154 0.14
155 0.15
156 0.14
157 0.16
158 0.17
159 0.17
160 0.15
161 0.17
162 0.16
163 0.19
164 0.24
165 0.26
166 0.27
167 0.32
168 0.32
169 0.34
170 0.38
171 0.36
172 0.37
173 0.36
174 0.38
175 0.34
176 0.36
177 0.33
178 0.3
179 0.29
180 0.27
181 0.25
182 0.22
183 0.22
184 0.19
185 0.17
186 0.16
187 0.15
188 0.18
189 0.17
190 0.16
191 0.17
192 0.17
193 0.17
194 0.18
195 0.16
196 0.12
197 0.13
198 0.14
199 0.17
200 0.16
201 0.16
202 0.16
203 0.2
204 0.24
205 0.24
206 0.26
207 0.33
208 0.44
209 0.53
210 0.63
211 0.69
212 0.73
213 0.83
214 0.9
215 0.92
216 0.92
217 0.93
218 0.94
219 0.94
220 0.94
221 0.94
222 0.93
223 0.89
224 0.88
225 0.83
226 0.8
227 0.78
228 0.76
229 0.74
230 0.66
231 0.61
232 0.54
233 0.48
234 0.4
235 0.32
236 0.24
237 0.16
238 0.15
239 0.16
240 0.13
241 0.14
242 0.13
243 0.12
244 0.12
245 0.11
246 0.11
247 0.12
248 0.12
249 0.12
250 0.15
251 0.22
252 0.28
253 0.36
254 0.44
255 0.45
256 0.54
257 0.59
258 0.66
259 0.63
260 0.67
261 0.67
262 0.65
263 0.62
264 0.55
265 0.5
266 0.42
267 0.36
268 0.26
269 0.17
270 0.1
271 0.06
272 0.04
273 0.03
274 0.03
275 0.03
276 0.03
277 0.03
278 0.04
279 0.04
280 0.04
281 0.04
282 0.04
283 0.05
284 0.06
285 0.06
286 0.06
287 0.06
288 0.07
289 0.07
290 0.07
291 0.06
292 0.06
293 0.06
294 0.06
295 0.05
296 0.05
297 0.05
298 0.05
299 0.06
300 0.06
301 0.05
302 0.05
303 0.06
304 0.06
305 0.06
306 0.07
307 0.08
308 0.08
309 0.12
310 0.18
311 0.23
312 0.24
313 0.25
314 0.31
315 0.31
316 0.32
317 0.28
318 0.22
319 0.17
320 0.17
321 0.16
322 0.09
323 0.1
324 0.08
325 0.07
326 0.07
327 0.09
328 0.08
329 0.08
330 0.09
331 0.11
332 0.13
333 0.18
334 0.24
335 0.27
336 0.33
337 0.43
338 0.52
339 0.59
340 0.66
341 0.7
342 0.68
343 0.7
344 0.65
345 0.57
346 0.49
347 0.44
348 0.4
349 0.3
350 0.27
351 0.21
352 0.19
353 0.16
354 0.14
355 0.08
356 0.05
357 0.05
358 0.04
359 0.05
360 0.05
361 0.05
362 0.05
363 0.05
364 0.05
365 0.04
366 0.04