Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4KFJ7

Protein Details
Accession W4KFJ7    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
157-185VFAEHLPTKKKRKLWRRKDQPKFEYPYKEBasic
NLS Segment(s)
PositionSequence
165-175KKKRKLWRRKD
Subcellular Location(s) nucl 15.5, cyto_nucl 13.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009446  Mgm101  
Gene Ontology GO:0000262  C:mitochondrial chromosome  
GO:0003697  F:single-stranded DNA binding  
GO:0006281  P:DNA repair  
GO:0000002  P:mitochondrial genome maintenance  
KEGG hir:HETIRDRAFT_472530  -  
Pfam View protein in Pfam  
PF06420  Mgm101p  
Amino Acid Sequences MPPPLSSESGAPTDWSRSYFGLSTQPFSKEVSEVLMAPVDPMDVEMKPDGLIYLPEIKYRRVLNKAFGPGGWGLAPRSETNVGPKVVSREYALVCLGRLVAIARGEQEYFDPSGIPTATEACKSNALMRCCKDLGVASELWDPRFIREFKSQHCVEVFAEHLPTKKKRKLWRRKDQPKFEYPYKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.21
4 0.19
5 0.22
6 0.21
7 0.21
8 0.26
9 0.26
10 0.28
11 0.29
12 0.3
13 0.28
14 0.29
15 0.28
16 0.2
17 0.19
18 0.18
19 0.16
20 0.14
21 0.14
22 0.13
23 0.11
24 0.11
25 0.1
26 0.07
27 0.06
28 0.06
29 0.07
30 0.06
31 0.08
32 0.08
33 0.09
34 0.09
35 0.09
36 0.08
37 0.07
38 0.07
39 0.07
40 0.14
41 0.14
42 0.18
43 0.2
44 0.2
45 0.24
46 0.28
47 0.32
48 0.32
49 0.34
50 0.36
51 0.4
52 0.43
53 0.4
54 0.35
55 0.32
56 0.25
57 0.23
58 0.18
59 0.12
60 0.09
61 0.09
62 0.11
63 0.08
64 0.11
65 0.12
66 0.12
67 0.16
68 0.19
69 0.19
70 0.18
71 0.18
72 0.18
73 0.17
74 0.18
75 0.14
76 0.13
77 0.13
78 0.13
79 0.13
80 0.1
81 0.09
82 0.09
83 0.08
84 0.05
85 0.05
86 0.04
87 0.05
88 0.06
89 0.06
90 0.06
91 0.07
92 0.08
93 0.08
94 0.08
95 0.08
96 0.08
97 0.08
98 0.08
99 0.07
100 0.08
101 0.08
102 0.08
103 0.06
104 0.08
105 0.09
106 0.11
107 0.12
108 0.12
109 0.14
110 0.14
111 0.2
112 0.24
113 0.27
114 0.31
115 0.32
116 0.35
117 0.34
118 0.33
119 0.28
120 0.24
121 0.24
122 0.21
123 0.19
124 0.17
125 0.21
126 0.22
127 0.21
128 0.22
129 0.2
130 0.19
131 0.25
132 0.24
133 0.24
134 0.33
135 0.37
136 0.39
137 0.47
138 0.45
139 0.42
140 0.42
141 0.39
142 0.31
143 0.29
144 0.25
145 0.19
146 0.21
147 0.18
148 0.21
149 0.26
150 0.34
151 0.41
152 0.47
153 0.54
154 0.62
155 0.72
156 0.8
157 0.84
158 0.87
159 0.89
160 0.93
161 0.96
162 0.96
163 0.94
164 0.92
165 0.89