Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4JZY9

Protein Details
Accession W4JZY9    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
9-30GRSKARKTYSGRAKAKKERVLQHydrophilic
NLS Segment(s)
PositionSequence
10-26RSKARKTYSGRAKAKKE
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 5
Family & Domain DBs
KEGG hir:HETIRDRAFT_224201  -  
Amino Acid Sequences MDDTHSSGGRSKARKTYSGRAKAKKERVLQAYRVSFIHSRELRGLSAARESESDTNANEDEDAAAMPPPPSPQKETTSTKVNANS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.57
3 0.62
4 0.65
5 0.71
6 0.74
7 0.74
8 0.8
9 0.82
10 0.84
11 0.82
12 0.77
13 0.75
14 0.74
15 0.7
16 0.65
17 0.63
18 0.55
19 0.49
20 0.42
21 0.37
22 0.3
23 0.26
24 0.31
25 0.24
26 0.23
27 0.24
28 0.25
29 0.22
30 0.21
31 0.2
32 0.12
33 0.14
34 0.12
35 0.11
36 0.1
37 0.12
38 0.12
39 0.13
40 0.13
41 0.11
42 0.13
43 0.13
44 0.12
45 0.1
46 0.09
47 0.07
48 0.07
49 0.07
50 0.05
51 0.05
52 0.06
53 0.06
54 0.07
55 0.1
56 0.15
57 0.18
58 0.23
59 0.28
60 0.32
61 0.4
62 0.47
63 0.49
64 0.52
65 0.51