Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4KNJ3

Protein Details
Accession W4KNJ3    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
16-41VLSLRCRLPVRKRCKERTNPRCPSCSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 13, cyto_nucl 7.5
Family & Domain DBs
KEGG hir:HETIRDRAFT_145454  -  
Amino Acid Sequences MHLSVSRARAGSDGCVLSLRCRLPVRKRCKERTNPRCPSCSLPSNPQRSRTPPAPPHLLIFTTPSATFAPRLRCTHPLEPGHPHESCI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.18
4 0.18
5 0.22
6 0.2
7 0.21
8 0.25
9 0.33
10 0.41
11 0.51
12 0.59
13 0.65
14 0.74
15 0.78
16 0.84
17 0.88
18 0.88
19 0.9
20 0.9
21 0.9
22 0.84
23 0.77
24 0.69
25 0.64
26 0.59
27 0.54
28 0.46
29 0.45
30 0.49
31 0.56
32 0.56
33 0.55
34 0.53
35 0.51
36 0.54
37 0.49
38 0.5
39 0.46
40 0.49
41 0.5
42 0.47
43 0.44
44 0.4
45 0.36
46 0.28
47 0.25
48 0.2
49 0.16
50 0.15
51 0.15
52 0.14
53 0.14
54 0.17
55 0.19
56 0.26
57 0.3
58 0.34
59 0.37
60 0.42
61 0.49
62 0.52
63 0.57
64 0.55
65 0.54
66 0.58
67 0.6
68 0.59