Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4KIW2

Protein Details
Accession W4KIW2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
88-109AVLNRGSNARPRPRQREHAADAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 14, cyto 4.5
Family & Domain DBs
KEGG hir:HETIRDRAFT_448271  -  
Amino Acid Sequences MFRLKPLKVYYCLTKCGHVIVKAGELATTQGTQFRVHSDSDEDLLATIRRRAPIPEVLHNCRPGGLVERAADLSDLRWTVEPEAQSGAVLNRGSNARPRPRQREHAADA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.4
3 0.41
4 0.41
5 0.33
6 0.32
7 0.26
8 0.27
9 0.25
10 0.24
11 0.18
12 0.13
13 0.12
14 0.11
15 0.1
16 0.08
17 0.1
18 0.11
19 0.12
20 0.12
21 0.14
22 0.14
23 0.14
24 0.15
25 0.16
26 0.15
27 0.16
28 0.15
29 0.12
30 0.1
31 0.11
32 0.1
33 0.08
34 0.1
35 0.1
36 0.12
37 0.12
38 0.13
39 0.16
40 0.22
41 0.25
42 0.3
43 0.35
44 0.39
45 0.42
46 0.41
47 0.38
48 0.31
49 0.28
50 0.21
51 0.2
52 0.16
53 0.16
54 0.15
55 0.16
56 0.16
57 0.15
58 0.15
59 0.1
60 0.09
61 0.08
62 0.08
63 0.08
64 0.09
65 0.1
66 0.12
67 0.15
68 0.14
69 0.13
70 0.15
71 0.14
72 0.13
73 0.13
74 0.12
75 0.13
76 0.13
77 0.11
78 0.12
79 0.14
80 0.16
81 0.23
82 0.31
83 0.38
84 0.48
85 0.58
86 0.66
87 0.73
88 0.81
89 0.82