Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4KEL8

Protein Details
Accession W4KEL8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
72-92GTAKGKSRKSRGTTGHRGRGLBasic
NLS Segment(s)
PositionSequence
75-90KGKSRKSRGTTGHRGR
Subcellular Location(s) cyto 10, mito 8, extr 5, cyto_pero 5
Family & Domain DBs
KEGG hir:HETIRDRAFT_244630  -  
Amino Acid Sequences CAEPCHPSTCPPCAVIEAARCWCGTTTRNVPCSANGGAALAPEIPCDRPCGARARAVRHQCTRALAALAGMGTAKGKSRKSRGTTGHRGRGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.26
4 0.26
5 0.26
6 0.26
7 0.24
8 0.23
9 0.22
10 0.22
11 0.19
12 0.22
13 0.29
14 0.34
15 0.37
16 0.38
17 0.38
18 0.35
19 0.37
20 0.3
21 0.21
22 0.15
23 0.13
24 0.11
25 0.1
26 0.1
27 0.06
28 0.05
29 0.05
30 0.06
31 0.06
32 0.06
33 0.09
34 0.1
35 0.1
36 0.12
37 0.18
38 0.19
39 0.25
40 0.29
41 0.33
42 0.41
43 0.47
44 0.51
45 0.5
46 0.52
47 0.47
48 0.47
49 0.41
50 0.34
51 0.28
52 0.21
53 0.16
54 0.13
55 0.11
56 0.08
57 0.06
58 0.05
59 0.05
60 0.05
61 0.1
62 0.15
63 0.21
64 0.29
65 0.38
66 0.47
67 0.53
68 0.62
69 0.68
70 0.73
71 0.78
72 0.8