Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1H4H8

Protein Details
Accession C1H4H8    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
42-72EVNRCLGRERYKRAQKNREKARENRKRIEEIBasic
NLS Segment(s)
PositionSequence
50-69ERYKRAQKNREKARENRKRI
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
KEGG pbl:PAAG_05671  -  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHSHLHTKHNTNCEEIMTMLDECHARGFLHKALAGCNEIKREVNRCLGRERYKRAQKNREKARENRKRIEEIWRKDDEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.3
3 0.23
4 0.17
5 0.16
6 0.12
7 0.12
8 0.11
9 0.09
10 0.1
11 0.1
12 0.07
13 0.09
14 0.13
15 0.13
16 0.15
17 0.16
18 0.16
19 0.16
20 0.18
21 0.18
22 0.16
23 0.16
24 0.15
25 0.14
26 0.16
27 0.16
28 0.19
29 0.2
30 0.27
31 0.29
32 0.3
33 0.34
34 0.4
35 0.48
36 0.51
37 0.56
38 0.58
39 0.65
40 0.72
41 0.78
42 0.81
43 0.82
44 0.85
45 0.88
46 0.88
47 0.86
48 0.87
49 0.88
50 0.88
51 0.86
52 0.85
53 0.81
54 0.77
55 0.72
56 0.73
57 0.72
58 0.7
59 0.68