Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4JT28

Protein Details
Accession W4JT28    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
83-102RGRCAVRRERHLPKAPPQGLBasic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 4
Family & Domain DBs
KEGG hir:HETIRDRAFT_411996  -  
Amino Acid Sequences MFLNSASAGSARVTALRSASNRSPMVLEIATLFVADGLNLWDRDLREELRAKVFNLGRKAIIERRPSKVVHLDCDVGRRRIERGRCAVRRERHLPKAPPQGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.17
4 0.18
5 0.23
6 0.26
7 0.31
8 0.3
9 0.3
10 0.29
11 0.25
12 0.27
13 0.2
14 0.17
15 0.11
16 0.11
17 0.1
18 0.09
19 0.08
20 0.05
21 0.05
22 0.04
23 0.04
24 0.04
25 0.06
26 0.06
27 0.07
28 0.08
29 0.09
30 0.11
31 0.13
32 0.13
33 0.15
34 0.19
35 0.2
36 0.23
37 0.24
38 0.22
39 0.26
40 0.27
41 0.28
42 0.27
43 0.27
44 0.22
45 0.23
46 0.26
47 0.26
48 0.3
49 0.35
50 0.36
51 0.4
52 0.43
53 0.42
54 0.43
55 0.45
56 0.41
57 0.36
58 0.35
59 0.33
60 0.3
61 0.37
62 0.37
63 0.32
64 0.31
65 0.29
66 0.31
67 0.36
68 0.42
69 0.43
70 0.48
71 0.56
72 0.6
73 0.67
74 0.72
75 0.72
76 0.75
77 0.76
78 0.76
79 0.75
80 0.79
81 0.78
82 0.79