Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1H061

Protein Details
Accession C1H061    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
41-69EVVRRQTSVRRLRGRRKKKGRGPGKTAPVBasic
82-107RASERERERGRERKRRRECVVVARAQBasic
NLS Segment(s)
PositionSequence
49-98VRRLRGRRKKKGRGPGKTAPVPCRKEGAVHPSERASERERERGRERKRRR
Subcellular Location(s) mito 17, cyto 5.5, cyto_nucl 5.5, nucl 4.5
Family & Domain DBs
KEGG pbl:PAAG_04155  -  
Amino Acid Sequences MAIAIATWLQMPQQPRLQIKRSNTGRGGVDGSETNEAAAREVVRRQTSVRRLRGRRKKKGRGPGKTAPVPCRKEGAVHPSERASERERERGRERKRRRECVVVARAQDGFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.37
3 0.44
4 0.5
5 0.54
6 0.57
7 0.62
8 0.62
9 0.63
10 0.57
11 0.54
12 0.49
13 0.44
14 0.4
15 0.29
16 0.25
17 0.19
18 0.18
19 0.16
20 0.14
21 0.12
22 0.12
23 0.11
24 0.1
25 0.1
26 0.09
27 0.09
28 0.11
29 0.16
30 0.15
31 0.16
32 0.18
33 0.25
34 0.34
35 0.41
36 0.48
37 0.53
38 0.6
39 0.7
40 0.79
41 0.82
42 0.83
43 0.85
44 0.87
45 0.86
46 0.89
47 0.88
48 0.86
49 0.84
50 0.81
51 0.78
52 0.74
53 0.69
54 0.67
55 0.65
56 0.6
57 0.52
58 0.47
59 0.4
60 0.37
61 0.37
62 0.38
63 0.34
64 0.32
65 0.33
66 0.31
67 0.34
68 0.32
69 0.31
70 0.26
71 0.29
72 0.32
73 0.4
74 0.43
75 0.48
76 0.55
77 0.62
78 0.69
79 0.72
80 0.78
81 0.79
82 0.86
83 0.89
84 0.87
85 0.87
86 0.84
87 0.84
88 0.83
89 0.78
90 0.7
91 0.63