Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JVP9

Protein Details
Accession W4JVP9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
177-196VRPESKVRKTIEKRRADPKRBasic
NLS Segment(s)
PositionSequence
182-196KVRKTIEKRRADPKR
Subcellular Location(s) cysk 14, cyto 9.5, cyto_nucl 7, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014729  Rossmann-like_a/b/a_fold  
IPR006016  UspA  
KEGG hir:HETIRDRAFT_242661  -  
Pfam View protein in Pfam  
PF00582  Usp  
CDD cd00293  USP_Like  
Amino Acid Sequences GYTPKVSFDTFENPAASMFSFTLSVKSDGYVRNRSTRVFLCAASADDSGRQALEWAIESLVQDGDELIVFRGIDQEELEKDHGMVRDDARELMRRIQDKCVDLDHNRKLSIVVEFIAGKTTQTIDRLIALYRPDSIVVGTRGTRGMMQAWGAAFGAPGMGSVSKYCLSHSPVPIIVVRPESKVRKTIEKRRADPKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.21
4 0.16
5 0.13
6 0.11
7 0.11
8 0.11
9 0.13
10 0.15
11 0.16
12 0.14
13 0.15
14 0.18
15 0.22
16 0.29
17 0.34
18 0.35
19 0.41
20 0.43
21 0.43
22 0.45
23 0.42
24 0.41
25 0.35
26 0.32
27 0.26
28 0.26
29 0.25
30 0.22
31 0.2
32 0.15
33 0.13
34 0.14
35 0.12
36 0.11
37 0.09
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.08
46 0.08
47 0.08
48 0.07
49 0.06
50 0.05
51 0.05
52 0.05
53 0.05
54 0.04
55 0.05
56 0.04
57 0.05
58 0.07
59 0.07
60 0.07
61 0.07
62 0.08
63 0.08
64 0.1
65 0.11
66 0.09
67 0.09
68 0.11
69 0.12
70 0.12
71 0.13
72 0.12
73 0.13
74 0.14
75 0.15
76 0.13
77 0.15
78 0.15
79 0.18
80 0.22
81 0.23
82 0.24
83 0.28
84 0.3
85 0.28
86 0.28
87 0.26
88 0.26
89 0.26
90 0.32
91 0.32
92 0.31
93 0.3
94 0.29
95 0.26
96 0.24
97 0.22
98 0.15
99 0.1
100 0.09
101 0.09
102 0.09
103 0.09
104 0.08
105 0.07
106 0.07
107 0.08
108 0.08
109 0.09
110 0.1
111 0.09
112 0.1
113 0.11
114 0.11
115 0.12
116 0.12
117 0.11
118 0.11
119 0.11
120 0.1
121 0.09
122 0.09
123 0.11
124 0.11
125 0.12
126 0.12
127 0.12
128 0.12
129 0.13
130 0.13
131 0.11
132 0.11
133 0.1
134 0.1
135 0.11
136 0.1
137 0.11
138 0.1
139 0.09
140 0.07
141 0.06
142 0.06
143 0.04
144 0.04
145 0.04
146 0.05
147 0.05
148 0.06
149 0.09
150 0.11
151 0.11
152 0.13
153 0.16
154 0.23
155 0.29
156 0.31
157 0.33
158 0.32
159 0.34
160 0.34
161 0.32
162 0.29
163 0.28
164 0.27
165 0.26
166 0.33
167 0.38
168 0.4
169 0.44
170 0.46
171 0.52
172 0.6
173 0.67
174 0.69
175 0.73
176 0.76