Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4JT63

Protein Details
Accession W4JT63    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MDQEGSRRRRRRQQRLRTISSLVHydrophilic
NLS Segment(s)
PositionSequence
7-12RRRRRR
Subcellular Location(s) mito 12, nucl 9, extr 3, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
KEGG hir:HETIRDRAFT_436611  -  
Amino Acid Sequences MDQEGSRRRRRRQQRLRTISSLVACLQGRADAGRDGHDARRPHNQHGTRPRPRTSLAYSGKSPANMLPPWLRTRGRIICAILGTKARTDGHVNERGKTRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.91
4 0.85
5 0.77
6 0.7
7 0.6
8 0.51
9 0.4
10 0.34
11 0.26
12 0.21
13 0.18
14 0.14
15 0.13
16 0.11
17 0.12
18 0.1
19 0.1
20 0.12
21 0.14
22 0.15
23 0.17
24 0.23
25 0.22
26 0.23
27 0.33
28 0.34
29 0.37
30 0.44
31 0.45
32 0.48
33 0.58
34 0.65
35 0.64
36 0.66
37 0.64
38 0.57
39 0.56
40 0.52
41 0.46
42 0.45
43 0.41
44 0.4
45 0.38
46 0.38
47 0.37
48 0.32
49 0.29
50 0.2
51 0.2
52 0.16
53 0.19
54 0.19
55 0.22
56 0.24
57 0.29
58 0.28
59 0.26
60 0.34
61 0.37
62 0.36
63 0.37
64 0.36
65 0.33
66 0.34
67 0.33
68 0.27
69 0.24
70 0.22
71 0.19
72 0.21
73 0.19
74 0.2
75 0.23
76 0.28
77 0.33
78 0.41
79 0.41
80 0.43