Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4KAY4

Protein Details
Accession W4KAY4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-33GLFSRIARQHRKRDDRCDSHRGBasic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
KEGG hir:HETIRDRAFT_384640  -  
Amino Acid Sequences MLSSASLLDRLGLFSRIARQHRKRDDRCDSHRGFTSLDHYWSLPQTSPSNDRWKPVRRASAIAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.19
3 0.25
4 0.31
5 0.4
6 0.47
7 0.56
8 0.66
9 0.75
10 0.76
11 0.79
12 0.83
13 0.82
14 0.8
15 0.8
16 0.71
17 0.64
18 0.59
19 0.5
20 0.41
21 0.32
22 0.3
23 0.22
24 0.21
25 0.18
26 0.16
27 0.16
28 0.16
29 0.17
30 0.13
31 0.15
32 0.16
33 0.2
34 0.24
35 0.28
36 0.37
37 0.37
38 0.42
39 0.47
40 0.54
41 0.59
42 0.63
43 0.67
44 0.61