Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4JM84

Protein Details
Accession W4JM84    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
36-60DGGWTQSPKKRRGKKTRGSGFRAKLBasic
NLS Segment(s)
PositionSequence
43-63PKKRRGKKTRGSGFRAKLPPK
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
KEGG hir:HETIRDRAFT_412652  -  
Amino Acid Sequences MCCKGRKKEGQTSTTLTIVLPAAPVSDDNETGMESDGGWTQSPKKRRGKKTRGSGFRAKLPPKWPHGDYNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.44
3 0.33
4 0.25
5 0.21
6 0.15
7 0.1
8 0.07
9 0.06
10 0.06
11 0.06
12 0.07
13 0.08
14 0.08
15 0.08
16 0.08
17 0.08
18 0.08
19 0.08
20 0.06
21 0.05
22 0.05
23 0.06
24 0.06
25 0.06
26 0.06
27 0.12
28 0.17
29 0.24
30 0.32
31 0.42
32 0.51
33 0.63
34 0.74
35 0.79
36 0.84
37 0.88
38 0.9
39 0.89
40 0.87
41 0.85
42 0.79
43 0.77
44 0.76
45 0.69
46 0.65
47 0.65
48 0.65
49 0.63
50 0.66
51 0.6