Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4KDY2

Protein Details
Accession W4KDY2    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
81-123PLDLRPKRTRAIRRRLTPHEKSLKTLKQRKKDIHFPQRKFAVKBasic
NLS Segment(s)
PositionSequence
85-119RPKRTRAIRRRLTPHEKSLKTLKQRKKDIHFPQRK
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG hir:HETIRDRAFT_415779  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLTKQLSELKTELLTLRVQKIAGGSASKLTKINTVRKSIARVLTVTNHKQRQNLRDFYKNKKYLPLDLRPKRTRAIRRRLTPHEKSLKTLKQRKKDIHFPQRKFAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.48
4 0.54
5 0.5
6 0.49
7 0.48
8 0.52
9 0.48
10 0.44
11 0.42
12 0.35
13 0.29
14 0.25
15 0.22
16 0.15
17 0.16
18 0.16
19 0.18
20 0.17
21 0.16
22 0.16
23 0.16
24 0.15
25 0.14
26 0.12
27 0.1
28 0.13
29 0.14
30 0.14
31 0.15
32 0.14
33 0.19
34 0.23
35 0.32
36 0.32
37 0.36
38 0.39
39 0.39
40 0.43
41 0.41
42 0.39
43 0.31
44 0.27
45 0.24
46 0.26
47 0.3
48 0.31
49 0.33
50 0.36
51 0.36
52 0.4
53 0.44
54 0.47
55 0.5
56 0.52
57 0.5
58 0.54
59 0.57
60 0.61
61 0.67
62 0.63
63 0.56
64 0.57
65 0.55
66 0.54
67 0.56
68 0.57
69 0.58
70 0.61
71 0.7
72 0.66
73 0.66
74 0.63
75 0.65
76 0.66
77 0.66
78 0.69
79 0.68
80 0.74
81 0.8
82 0.85
83 0.85
84 0.81
85 0.81
86 0.8
87 0.72
88 0.67
89 0.68
90 0.67
91 0.67
92 0.71
93 0.7
94 0.7
95 0.79
96 0.84
97 0.83
98 0.85
99 0.86
100 0.87
101 0.88
102 0.83
103 0.83
104 0.82