Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4K1Y2

Protein Details
Accession W4K1Y2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MEKIKKEESRTKRNKQTSIGLKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, pero 4, cyto 2
Family & Domain DBs
KEGG hir:HETIRDRAFT_411040  -  
Amino Acid Sequences MEKIKKEESRTKRNKQTSIGLKAGRTAGQNKVAARGRGKHACSVALLQRDLQAVSDPFFLLSRDVLGECARRANGVSLDERRCARKAPPEPQEVDLCCRVMAESLGHREGDNQYVRRWDMGWPMDVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.8
3 0.81
4 0.79
5 0.76
6 0.73
7 0.64
8 0.55
9 0.51
10 0.47
11 0.39
12 0.33
13 0.28
14 0.26
15 0.3
16 0.32
17 0.3
18 0.36
19 0.38
20 0.38
21 0.39
22 0.38
23 0.39
24 0.44
25 0.45
26 0.41
27 0.38
28 0.35
29 0.32
30 0.31
31 0.28
32 0.24
33 0.23
34 0.19
35 0.2
36 0.19
37 0.18
38 0.15
39 0.12
40 0.09
41 0.1
42 0.1
43 0.08
44 0.08
45 0.08
46 0.08
47 0.07
48 0.06
49 0.05
50 0.05
51 0.05
52 0.06
53 0.07
54 0.08
55 0.08
56 0.09
57 0.09
58 0.09
59 0.09
60 0.1
61 0.11
62 0.12
63 0.16
64 0.2
65 0.22
66 0.25
67 0.26
68 0.27
69 0.26
70 0.27
71 0.27
72 0.32
73 0.38
74 0.45
75 0.51
76 0.54
77 0.55
78 0.56
79 0.57
80 0.48
81 0.44
82 0.37
83 0.3
84 0.24
85 0.21
86 0.18
87 0.14
88 0.13
89 0.12
90 0.14
91 0.19
92 0.2
93 0.2
94 0.2
95 0.22
96 0.23
97 0.27
98 0.3
99 0.27
100 0.29
101 0.34
102 0.35
103 0.33
104 0.32
105 0.29
106 0.3
107 0.32