Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4JXF2

Protein Details
Accession W4JXF2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-24RVTLRKRQPYNTTSNRRRIVKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG hir:HETIRDRAFT_411721  -  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRVTLRKRQPYNTTSNRRRIVKTPGGVLRYHHIKKLATAPKCGDCGSKLSGIPALRPREYATISKTQKNVSRAYGGSRCGTCVRSRVVRAFLIEEAKIVKRVIKQQTSSRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.79
4 0.81
5 0.8
6 0.76
7 0.74
8 0.69
9 0.68
10 0.66
11 0.6
12 0.58
13 0.56
14 0.53
15 0.49
16 0.45
17 0.41
18 0.41
19 0.4
20 0.35
21 0.33
22 0.3
23 0.33
24 0.41
25 0.43
26 0.36
27 0.38
28 0.39
29 0.38
30 0.39
31 0.37
32 0.28
33 0.21
34 0.22
35 0.2
36 0.19
37 0.16
38 0.15
39 0.18
40 0.16
41 0.18
42 0.21
43 0.23
44 0.21
45 0.21
46 0.22
47 0.22
48 0.24
49 0.24
50 0.22
51 0.28
52 0.3
53 0.34
54 0.34
55 0.36
56 0.39
57 0.4
58 0.39
59 0.32
60 0.33
61 0.3
62 0.34
63 0.33
64 0.3
65 0.3
66 0.27
67 0.27
68 0.25
69 0.27
70 0.23
71 0.23
72 0.26
73 0.29
74 0.33
75 0.35
76 0.37
77 0.37
78 0.37
79 0.35
80 0.33
81 0.29
82 0.25
83 0.21
84 0.21
85 0.2
86 0.21
87 0.19
88 0.2
89 0.23
90 0.32
91 0.41
92 0.46
93 0.51