Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4KKE0

Protein Details
Accession W4KKE0    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
60-79ASRSRPPSERNNKKSNPICHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 14.5, cyto 7.5
Family & Domain DBs
KEGG hir:HETIRDRAFT_471689  -  
Amino Acid Sequences MEEDQNEHINNYYLERNAIIGDSYGAVGPSGSTPTSTPLRLPTQGACLRVCSCQPPARVASRSRPPSERNNKKSNPICHGVLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.16
4 0.14
5 0.13
6 0.11
7 0.08
8 0.08
9 0.07
10 0.07
11 0.06
12 0.06
13 0.05
14 0.05
15 0.05
16 0.05
17 0.06
18 0.05
19 0.06
20 0.06
21 0.1
22 0.12
23 0.13
24 0.13
25 0.16
26 0.18
27 0.19
28 0.2
29 0.17
30 0.22
31 0.24
32 0.26
33 0.22
34 0.21
35 0.21
36 0.22
37 0.22
38 0.17
39 0.2
40 0.23
41 0.24
42 0.26
43 0.28
44 0.33
45 0.36
46 0.38
47 0.42
48 0.46
49 0.52
50 0.53
51 0.55
52 0.54
53 0.61
54 0.68
55 0.71
56 0.69
57 0.73
58 0.73
59 0.78
60 0.82
61 0.79
62 0.75
63 0.7