Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4K9P5

Protein Details
Accession W4K9P5   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
69-94RAEHPPSHRLRRLRRPHPRRPLANITBasic
NLS Segment(s)
PositionSequence
74-90PSHRLRRLRRPHPRRPL
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
KEGG hir:HETIRDRAFT_433543  -  
Amino Acid Sequences MSVLPRRTLDALAPPSTYVTRTLHERFTFTFAPLSPPRFPGSYSAVFPLGRLAGQGSTPSPHCSPYAHRAEHPPSHRLRRLRRPHPRRPLANITSRTTPRPRPLVARSSSTPTSRHAAPLYAAPFSSPFHHIASPPLRRTPTPPVSAHVTTPQTTLGHPPSGLQRSRSSSLSLDEMLLQVATDDRSHAGSPTGALLALSASAGAVLTEPKKIMDLRGHSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.29
4 0.27
5 0.22
6 0.19
7 0.2
8 0.26
9 0.3
10 0.35
11 0.35
12 0.38
13 0.36
14 0.4
15 0.38
16 0.32
17 0.32
18 0.24
19 0.3
20 0.31
21 0.34
22 0.3
23 0.31
24 0.33
25 0.3
26 0.31
27 0.28
28 0.3
29 0.28
30 0.28
31 0.28
32 0.27
33 0.26
34 0.25
35 0.22
36 0.16
37 0.13
38 0.11
39 0.1
40 0.08
41 0.09
42 0.1
43 0.09
44 0.11
45 0.12
46 0.16
47 0.15
48 0.16
49 0.17
50 0.18
51 0.23
52 0.3
53 0.37
54 0.35
55 0.36
56 0.42
57 0.47
58 0.52
59 0.5
60 0.48
61 0.46
62 0.52
63 0.56
64 0.58
65 0.61
66 0.65
67 0.72
68 0.76
69 0.81
70 0.82
71 0.87
72 0.89
73 0.89
74 0.83
75 0.81
76 0.79
77 0.74
78 0.72
79 0.66
80 0.58
81 0.55
82 0.51
83 0.48
84 0.43
85 0.42
86 0.39
87 0.39
88 0.38
89 0.39
90 0.42
91 0.45
92 0.42
93 0.41
94 0.38
95 0.38
96 0.38
97 0.34
98 0.3
99 0.25
100 0.25
101 0.22
102 0.22
103 0.18
104 0.16
105 0.15
106 0.17
107 0.16
108 0.13
109 0.13
110 0.1
111 0.11
112 0.11
113 0.13
114 0.11
115 0.12
116 0.14
117 0.15
118 0.15
119 0.2
120 0.27
121 0.31
122 0.31
123 0.34
124 0.34
125 0.34
126 0.39
127 0.42
128 0.41
129 0.41
130 0.4
131 0.38
132 0.43
133 0.43
134 0.39
135 0.35
136 0.31
137 0.26
138 0.25
139 0.24
140 0.18
141 0.18
142 0.22
143 0.19
144 0.18
145 0.17
146 0.18
147 0.23
148 0.29
149 0.3
150 0.28
151 0.31
152 0.35
153 0.39
154 0.38
155 0.34
156 0.29
157 0.3
158 0.29
159 0.24
160 0.19
161 0.16
162 0.15
163 0.13
164 0.11
165 0.08
166 0.06
167 0.06
168 0.06
169 0.06
170 0.07
171 0.08
172 0.1
173 0.11
174 0.11
175 0.12
176 0.11
177 0.11
178 0.12
179 0.11
180 0.09
181 0.08
182 0.08
183 0.07
184 0.06
185 0.05
186 0.04
187 0.03
188 0.03
189 0.03
190 0.03
191 0.04
192 0.07
193 0.08
194 0.1
195 0.11
196 0.12
197 0.15
198 0.16
199 0.21
200 0.26