Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JZH7

Protein Details
Accession W4JZH7    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
326-353VARAARWRSSRAQRAPRPHRSRARRTPAHydrophilic
NLS Segment(s)
PositionSequence
323-353PRRVARAARWRSSRAQRAPRPHRSRARRTPA
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 5, cyto 3
Family & Domain DBs
KEGG hir:HETIRDRAFT_325078  -  
Amino Acid Sequences MTFSSAIDTAGVCPRWNSPPCRSQTQSSRNLSPSNFDPSTLAELLSVRAPTPQPPFTFKTHALFCFAEPAAMSFPQDIPNVSSLPRSLITDHDGSPTRYRNASIDSDRASHVRYSPTPHATTTPSTPTSASASTPSTLTRPSTYPSPVASPFLPPPSHPPSPPATASMKTPAAVAPTPPAYSPVSPSPAARPRGHIDEAGGAHQRTLTPEDLRMRHLSQDHNPSLLVSLDHDRRSDLALPMYQAALIQDHSDSNFGPTEEFAAEKARLGLSDSSQNGIRRSSVTAHRRGTRLRAQRRVARACLTRCSPSAARRASASSATATPRRVARAARWRSSRAQRAPRPHRSRARRTPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.3
3 0.37
4 0.41
5 0.43
6 0.51
7 0.57
8 0.64
9 0.65
10 0.65
11 0.69
12 0.72
13 0.74
14 0.72
15 0.72
16 0.67
17 0.68
18 0.59
19 0.54
20 0.47
21 0.46
22 0.4
23 0.33
24 0.3
25 0.28
26 0.33
27 0.28
28 0.24
29 0.16
30 0.17
31 0.17
32 0.18
33 0.16
34 0.1
35 0.13
36 0.14
37 0.19
38 0.25
39 0.3
40 0.3
41 0.36
42 0.4
43 0.42
44 0.47
45 0.45
46 0.45
47 0.44
48 0.42
49 0.41
50 0.38
51 0.33
52 0.32
53 0.29
54 0.23
55 0.18
56 0.18
57 0.16
58 0.15
59 0.15
60 0.11
61 0.12
62 0.15
63 0.16
64 0.15
65 0.14
66 0.16
67 0.16
68 0.15
69 0.16
70 0.13
71 0.15
72 0.15
73 0.14
74 0.14
75 0.15
76 0.19
77 0.2
78 0.2
79 0.22
80 0.23
81 0.25
82 0.29
83 0.3
84 0.29
85 0.28
86 0.28
87 0.26
88 0.28
89 0.32
90 0.3
91 0.3
92 0.29
93 0.3
94 0.3
95 0.29
96 0.26
97 0.21
98 0.2
99 0.21
100 0.21
101 0.26
102 0.31
103 0.35
104 0.35
105 0.34
106 0.34
107 0.32
108 0.33
109 0.29
110 0.28
111 0.24
112 0.23
113 0.23
114 0.22
115 0.21
116 0.19
117 0.17
118 0.14
119 0.14
120 0.14
121 0.14
122 0.13
123 0.12
124 0.13
125 0.14
126 0.14
127 0.13
128 0.15
129 0.18
130 0.2
131 0.2
132 0.2
133 0.21
134 0.2
135 0.21
136 0.19
137 0.19
138 0.18
139 0.2
140 0.2
141 0.17
142 0.22
143 0.27
144 0.29
145 0.26
146 0.28
147 0.28
148 0.31
149 0.31
150 0.28
151 0.24
152 0.23
153 0.23
154 0.24
155 0.2
156 0.17
157 0.17
158 0.14
159 0.13
160 0.12
161 0.12
162 0.1
163 0.1
164 0.1
165 0.1
166 0.12
167 0.11
168 0.11
169 0.14
170 0.14
171 0.16
172 0.16
173 0.17
174 0.21
175 0.27
176 0.31
177 0.29
178 0.31
179 0.31
180 0.35
181 0.36
182 0.3
183 0.24
184 0.22
185 0.22
186 0.2
187 0.19
188 0.14
189 0.13
190 0.13
191 0.12
192 0.1
193 0.13
194 0.13
195 0.12
196 0.16
197 0.22
198 0.23
199 0.26
200 0.27
201 0.25
202 0.27
203 0.29
204 0.29
205 0.29
206 0.37
207 0.35
208 0.33
209 0.32
210 0.28
211 0.26
212 0.22
213 0.16
214 0.09
215 0.13
216 0.16
217 0.18
218 0.18
219 0.18
220 0.18
221 0.2
222 0.21
223 0.18
224 0.17
225 0.16
226 0.17
227 0.17
228 0.16
229 0.14
230 0.1
231 0.09
232 0.07
233 0.07
234 0.07
235 0.07
236 0.07
237 0.08
238 0.09
239 0.08
240 0.09
241 0.1
242 0.1
243 0.1
244 0.09
245 0.11
246 0.1
247 0.1
248 0.09
249 0.11
250 0.11
251 0.12
252 0.13
253 0.11
254 0.1
255 0.13
256 0.14
257 0.13
258 0.19
259 0.19
260 0.2
261 0.24
262 0.26
263 0.25
264 0.24
265 0.24
266 0.19
267 0.21
268 0.25
269 0.31
270 0.36
271 0.43
272 0.49
273 0.53
274 0.56
275 0.57
276 0.59
277 0.59
278 0.62
279 0.64
280 0.67
281 0.7
282 0.73
283 0.79
284 0.79
285 0.73
286 0.71
287 0.68
288 0.63
289 0.62
290 0.58
291 0.53
292 0.46
293 0.49
294 0.46
295 0.45
296 0.5
297 0.47
298 0.44
299 0.42
300 0.44
301 0.4
302 0.37
303 0.33
304 0.26
305 0.26
306 0.3
307 0.31
308 0.3
309 0.31
310 0.32
311 0.35
312 0.36
313 0.37
314 0.41
315 0.48
316 0.56
317 0.61
318 0.64
319 0.65
320 0.71
321 0.77
322 0.77
323 0.77
324 0.79
325 0.79
326 0.83
327 0.89
328 0.9
329 0.89
330 0.88
331 0.89
332 0.89
333 0.91