Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4JSP8

Protein Details
Accession W4JSP8    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
213-238GDATMRSRPRRTTKHPSRPPGYLRPAHydrophilic
NLS Segment(s)
PositionSequence
40-67RIRRAPARAPARTARERRSIGPTPRRTP
82-82R
197-241SAFEKGPAKKPINRDAGDATMRSRPRRTTKHPSRPPGYLRPAPQR
Subcellular Location(s) mito 13, nucl 8, cyto_mito 8
Family & Domain DBs
KEGG hir:HETIRDRAFT_455696  -  
Amino Acid Sequences MCLHPAVHIWKTALTARFLPQKPPVTTLDTPAQLWLIASRIRRAPARAPARTARERRSIGPTPRRTPAPSVAACGSKRALARAARRWRGICRRGDDTGLEIARTAAHSSFLVPSCKETRISPALPVWGSTPSRLSHSPPRSARHHSSLVPASSARISHRIVLAHPFAPNNERTSFENESEDASKRPIHIPRGIERASAFEKGPAKKPINRDAGDATMRSRPRRTTKHPSRPPGYLRPAPQRRGGTPTTTPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.31
4 0.4
5 0.4
6 0.43
7 0.45
8 0.51
9 0.5
10 0.51
11 0.49
12 0.47
13 0.47
14 0.46
15 0.44
16 0.37
17 0.35
18 0.32
19 0.29
20 0.2
21 0.19
22 0.15
23 0.11
24 0.13
25 0.15
26 0.18
27 0.21
28 0.25
29 0.28
30 0.32
31 0.36
32 0.42
33 0.5
34 0.49
35 0.52
36 0.55
37 0.6
38 0.65
39 0.65
40 0.62
41 0.61
42 0.61
43 0.58
44 0.6
45 0.6
46 0.61
47 0.65
48 0.67
49 0.63
50 0.65
51 0.65
52 0.59
53 0.56
54 0.52
55 0.5
56 0.42
57 0.4
58 0.38
59 0.39
60 0.36
61 0.33
62 0.27
63 0.22
64 0.22
65 0.2
66 0.23
67 0.25
68 0.32
69 0.39
70 0.49
71 0.5
72 0.54
73 0.55
74 0.59
75 0.63
76 0.63
77 0.6
78 0.55
79 0.54
80 0.52
81 0.51
82 0.42
83 0.34
84 0.32
85 0.25
86 0.2
87 0.15
88 0.13
89 0.12
90 0.12
91 0.1
92 0.05
93 0.06
94 0.06
95 0.07
96 0.1
97 0.11
98 0.12
99 0.12
100 0.15
101 0.16
102 0.18
103 0.18
104 0.16
105 0.2
106 0.23
107 0.23
108 0.22
109 0.2
110 0.21
111 0.2
112 0.2
113 0.15
114 0.14
115 0.14
116 0.13
117 0.14
118 0.12
119 0.16
120 0.16
121 0.19
122 0.26
123 0.3
124 0.38
125 0.4
126 0.45
127 0.46
128 0.52
129 0.53
130 0.49
131 0.48
132 0.41
133 0.42
134 0.4
135 0.35
136 0.29
137 0.25
138 0.2
139 0.17
140 0.17
141 0.13
142 0.14
143 0.14
144 0.15
145 0.17
146 0.16
147 0.17
148 0.2
149 0.21
150 0.18
151 0.18
152 0.17
153 0.16
154 0.19
155 0.2
156 0.19
157 0.18
158 0.19
159 0.2
160 0.27
161 0.29
162 0.27
163 0.27
164 0.24
165 0.26
166 0.26
167 0.25
168 0.19
169 0.18
170 0.18
171 0.18
172 0.23
173 0.26
174 0.29
175 0.33
176 0.37
177 0.41
178 0.47
179 0.46
180 0.42
181 0.37
182 0.36
183 0.33
184 0.3
185 0.25
186 0.22
187 0.28
188 0.3
189 0.37
190 0.4
191 0.43
192 0.46
193 0.53
194 0.58
195 0.6
196 0.58
197 0.55
198 0.5
199 0.5
200 0.48
201 0.41
202 0.34
203 0.32
204 0.36
205 0.37
206 0.39
207 0.42
208 0.5
209 0.59
210 0.66
211 0.7
212 0.76
213 0.83
214 0.88
215 0.89
216 0.85
217 0.84
218 0.82
219 0.81
220 0.79
221 0.75
222 0.73
223 0.74
224 0.77
225 0.73
226 0.74
227 0.7
228 0.64
229 0.64
230 0.59
231 0.55