Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JY01

Protein Details
Accession W4JY01    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
150-172KAAGKKRKSGAEHKGPKPKKKKRBasic
NLS Segment(s)
PositionSequence
149-172PKAAGKKRKSGAEHKGPKPKKKKR
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046520  DUF6697  
KEGG hir:HETIRDRAFT_325418  -  
Pfam View protein in Pfam  
PF20411  DUF6697  
Amino Acid Sequences MFFHTSDINHGLVVLPVYRFFPEGVDQKNKKTQWQLNPMAPARGQVRDVFLRRDQVSWIYLGEYQCVFSDVVDLNSVPFVKRNHVVQNTIMQKDLATRVSENMIKSMYTSSILKVQCFGLQCVGFNEELDRQLHDQSGKSGSAAPQSSPKAAGKKRKSGAEHKGPKPKKKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.09
4 0.11
5 0.12
6 0.12
7 0.12
8 0.13
9 0.17
10 0.22
11 0.28
12 0.37
13 0.39
14 0.44
15 0.52
16 0.52
17 0.52
18 0.56
19 0.58
20 0.58
21 0.66
22 0.66
23 0.62
24 0.69
25 0.64
26 0.56
27 0.48
28 0.42
29 0.34
30 0.29
31 0.26
32 0.2
33 0.23
34 0.26
35 0.28
36 0.29
37 0.28
38 0.33
39 0.32
40 0.32
41 0.29
42 0.25
43 0.23
44 0.19
45 0.17
46 0.12
47 0.14
48 0.13
49 0.13
50 0.11
51 0.11
52 0.1
53 0.11
54 0.1
55 0.07
56 0.09
57 0.08
58 0.09
59 0.08
60 0.08
61 0.07
62 0.08
63 0.08
64 0.06
65 0.09
66 0.09
67 0.12
68 0.14
69 0.17
70 0.23
71 0.25
72 0.27
73 0.25
74 0.31
75 0.32
76 0.31
77 0.28
78 0.21
79 0.19
80 0.19
81 0.19
82 0.13
83 0.11
84 0.1
85 0.11
86 0.14
87 0.16
88 0.15
89 0.14
90 0.13
91 0.12
92 0.12
93 0.12
94 0.1
95 0.1
96 0.1
97 0.1
98 0.16
99 0.16
100 0.16
101 0.16
102 0.16
103 0.17
104 0.18
105 0.18
106 0.16
107 0.16
108 0.16
109 0.16
110 0.17
111 0.15
112 0.14
113 0.15
114 0.12
115 0.13
116 0.13
117 0.14
118 0.14
119 0.15
120 0.17
121 0.17
122 0.17
123 0.17
124 0.2
125 0.18
126 0.17
127 0.19
128 0.18
129 0.23
130 0.23
131 0.21
132 0.25
133 0.28
134 0.28
135 0.3
136 0.33
137 0.36
138 0.43
139 0.52
140 0.54
141 0.62
142 0.67
143 0.72
144 0.74
145 0.75
146 0.78
147 0.78
148 0.8
149 0.79
150 0.84
151 0.84
152 0.88