Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4KFZ9

Protein Details
Accession W4KFZ9    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAKSKNHTNHNQNKKAHRNGIRKPVAHydrophilic
NLS Segment(s)
PositionSequence
14-55KKAHRNGIRKPVAGRTRSLKGVDAKFRRNSRFALNGSRKARV
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG hir:HETIRDRAFT_458098  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIRKPVAGRTRSLKGVDAKFRRNSRFALNGSRKARVEAKAAAAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.8
6 0.79
7 0.82
8 0.78
9 0.7
10 0.64
11 0.63
12 0.6
13 0.52
14 0.47
15 0.41
16 0.39
17 0.39
18 0.37
19 0.31
20 0.3
21 0.34
22 0.4
23 0.4
24 0.43
25 0.48
26 0.53
27 0.54
28 0.51
29 0.48
30 0.45
31 0.47
32 0.44
33 0.48
34 0.49
35 0.55
36 0.55
37 0.59
38 0.53
39 0.5
40 0.52
41 0.45
42 0.42
43 0.37
44 0.38