Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4KBG0

Protein Details
Accession W4KBG0    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MFKRVEKRRKRREDEEELGIDBasic
NLS Segment(s)
PositionSequence
6-12EKRRKRR
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
KEGG hir:HETIRDRAFT_409079  -  
Amino Acid Sequences MFKRVEKRRKRREDEEELGIDEEMKEVLGLQDTDSSESESGSDSDSDSDISNDDGDASASGMLKRKRVKGSESEGDDSGLANNVVGDEEEEGEDVVESDEDETDHPDSGPQITVAEALQDPLYVVSMDPEIQSCVLCPGKRLKNPAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.81
3 0.72
4 0.62
5 0.54
6 0.43
7 0.33
8 0.23
9 0.17
10 0.09
11 0.07
12 0.05
13 0.04
14 0.05
15 0.06
16 0.07
17 0.07
18 0.1
19 0.11
20 0.13
21 0.13
22 0.15
23 0.13
24 0.13
25 0.12
26 0.1
27 0.1
28 0.09
29 0.09
30 0.07
31 0.08
32 0.08
33 0.09
34 0.08
35 0.08
36 0.07
37 0.07
38 0.07
39 0.06
40 0.06
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.11
49 0.12
50 0.18
51 0.22
52 0.27
53 0.32
54 0.35
55 0.38
56 0.39
57 0.45
58 0.46
59 0.45
60 0.41
61 0.36
62 0.33
63 0.3
64 0.23
65 0.16
66 0.1
67 0.06
68 0.04
69 0.04
70 0.03
71 0.04
72 0.03
73 0.04
74 0.03
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.03
84 0.03
85 0.04
86 0.04
87 0.04
88 0.05
89 0.07
90 0.08
91 0.08
92 0.08
93 0.08
94 0.09
95 0.1
96 0.1
97 0.08
98 0.07
99 0.07
100 0.08
101 0.07
102 0.09
103 0.07
104 0.08
105 0.08
106 0.07
107 0.07
108 0.07
109 0.08
110 0.06
111 0.06
112 0.06
113 0.07
114 0.08
115 0.08
116 0.09
117 0.09
118 0.1
119 0.1
120 0.09
121 0.14
122 0.19
123 0.19
124 0.22
125 0.31
126 0.4
127 0.46