Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4K829

Protein Details
Accession W4K829    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
74-100TSAFKHPYPAPRRKRRAAKFGVPPRRLHydrophilic
NLS Segment(s)
PositionSequence
81-99YPAPRRKRRAAKFGVPPRR
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 8
Family & Domain DBs
KEGG hir:HETIRDRAFT_452598  -  
Amino Acid Sequences MAHASVHRVDLPESKPDRTRASTVVIKVQPPSTPPSYTTSTLLRAFDRAWPAPLRAALARKGPPPTTHAETKITSAFKHPYPAPRRKRRAAKFGVPPRRLGAPTFVRSLGRSIDDYTYSASFFFFFRVGRRSAAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.44
4 0.48
5 0.46
6 0.48
7 0.4
8 0.44
9 0.44
10 0.42
11 0.46
12 0.42
13 0.38
14 0.37
15 0.36
16 0.3
17 0.27
18 0.3
19 0.25
20 0.24
21 0.25
22 0.27
23 0.3
24 0.31
25 0.31
26 0.28
27 0.28
28 0.29
29 0.28
30 0.24
31 0.21
32 0.2
33 0.21
34 0.24
35 0.2
36 0.21
37 0.21
38 0.21
39 0.21
40 0.2
41 0.19
42 0.16
43 0.18
44 0.17
45 0.2
46 0.21
47 0.22
48 0.25
49 0.25
50 0.24
51 0.25
52 0.28
53 0.27
54 0.28
55 0.27
56 0.28
57 0.27
58 0.27
59 0.28
60 0.23
61 0.19
62 0.2
63 0.2
64 0.18
65 0.22
66 0.22
67 0.28
68 0.36
69 0.46
70 0.53
71 0.61
72 0.69
73 0.74
74 0.83
75 0.81
76 0.83
77 0.81
78 0.79
79 0.79
80 0.81
81 0.83
82 0.73
83 0.67
84 0.59
85 0.55
86 0.48
87 0.38
88 0.36
89 0.32
90 0.34
91 0.34
92 0.33
93 0.3
94 0.3
95 0.3
96 0.25
97 0.2
98 0.19
99 0.19
100 0.2
101 0.2
102 0.2
103 0.21
104 0.19
105 0.17
106 0.15
107 0.13
108 0.12
109 0.11
110 0.12
111 0.1
112 0.11
113 0.15
114 0.2
115 0.21
116 0.23