Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4JU50

Protein Details
Accession W4JU50    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-45VLKIRNEPKSKVPPRNKRPRLVRAADHydrophilic
NLS Segment(s)
PositionSequence
24-42RNEPKSKVPPRNKRPRLVR
Subcellular Location(s) mito 17, nucl 7.5, cyto_nucl 5.5
Family & Domain DBs
KEGG hir:HETIRDRAFT_105713  -  
Amino Acid Sequences MPEPTTGSVSSRRAPSPSFVLKIRNEPKSKVPPRNKRPRLVRAADIPASRVDRPPHVRNPRALPAAVCKDERLMGRSFAELCWPGLGEKISASGHMYARTLILMHGEGEILQLGRVRGLDLVHRCSLACFPYMRDGKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.38
4 0.4
5 0.39
6 0.37
7 0.42
8 0.42
9 0.5
10 0.53
11 0.54
12 0.52
13 0.52
14 0.58
15 0.62
16 0.69
17 0.69
18 0.73
19 0.75
20 0.82
21 0.9
22 0.89
23 0.87
24 0.87
25 0.87
26 0.85
27 0.79
28 0.73
29 0.67
30 0.65
31 0.59
32 0.5
33 0.41
34 0.34
35 0.32
36 0.28
37 0.25
38 0.22
39 0.25
40 0.32
41 0.37
42 0.44
43 0.5
44 0.53
45 0.54
46 0.58
47 0.56
48 0.51
49 0.45
50 0.36
51 0.33
52 0.34
53 0.31
54 0.26
55 0.2
56 0.18
57 0.21
58 0.2
59 0.18
60 0.14
61 0.14
62 0.14
63 0.15
64 0.15
65 0.12
66 0.14
67 0.12
68 0.11
69 0.09
70 0.09
71 0.08
72 0.09
73 0.1
74 0.07
75 0.07
76 0.09
77 0.08
78 0.09
79 0.1
80 0.11
81 0.12
82 0.13
83 0.13
84 0.11
85 0.11
86 0.11
87 0.1
88 0.07
89 0.08
90 0.07
91 0.07
92 0.07
93 0.07
94 0.06
95 0.06
96 0.07
97 0.06
98 0.06
99 0.07
100 0.07
101 0.08
102 0.08
103 0.08
104 0.09
105 0.1
106 0.17
107 0.2
108 0.25
109 0.26
110 0.26
111 0.26
112 0.26
113 0.28
114 0.23
115 0.21
116 0.17
117 0.19
118 0.28