Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4KI02

Protein Details
Accession W4KI02    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
49-73LFECMRTTPFKTKKQRPTINYHLARHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG hir:HETIRDRAFT_44209  -  
Amino Acid Sequences MHIKNLKVRPQKNTSTTLCAPELAQMLGCWAATKDHLSVDKCASAATTLFECMRTTPFKTKKQRPTINYHLARLGKHLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.61
3 0.57
4 0.53
5 0.45
6 0.37
7 0.32
8 0.27
9 0.24
10 0.16
11 0.14
12 0.09
13 0.09
14 0.09
15 0.08
16 0.06
17 0.05
18 0.06
19 0.06
20 0.08
21 0.07
22 0.09
23 0.13
24 0.14
25 0.16
26 0.17
27 0.16
28 0.15
29 0.14
30 0.12
31 0.09
32 0.08
33 0.08
34 0.07
35 0.07
36 0.08
37 0.09
38 0.09
39 0.09
40 0.12
41 0.14
42 0.18
43 0.28
44 0.36
45 0.45
46 0.56
47 0.65
48 0.72
49 0.8
50 0.86
51 0.82
52 0.83
53 0.83
54 0.84
55 0.78
56 0.7
57 0.66
58 0.59
59 0.54