Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1H7Z1

Protein Details
Accession C1H7Z1   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
97-134AAEKVEKASRQQRKQRKNRSKKFRGTEKTKGPKKDKKKBasic
NLS Segment(s)
PositionSequence
98-134AEKVEKASRQQRKQRKNRSKKFRGTEKTKGPKKDKKK
Subcellular Location(s) mito 17.5, cyto_mito 11.5, nucl 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pbl:PAAG_06882  -  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADAPVTLRTRKFIRNPLLARKQIVVDILHPNRANISKDELRGKLSELYKSNKEQVSVFGLRTHYGGGKTTGFALIYDSTEALKKFEPRYRLVRIGAAEKVEKASRQQRKQRKNRSKKFRGTEKTKGPKKDKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.67
4 0.72
5 0.77
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.22
14 0.29
15 0.28
16 0.32
17 0.3
18 0.29
19 0.3
20 0.32
21 0.31
22 0.23
23 0.29
24 0.27
25 0.31
26 0.36
27 0.34
28 0.33
29 0.31
30 0.31
31 0.29
32 0.27
33 0.29
34 0.27
35 0.31
36 0.33
37 0.35
38 0.39
39 0.34
40 0.33
41 0.28
42 0.26
43 0.28
44 0.25
45 0.23
46 0.19
47 0.19
48 0.18
49 0.18
50 0.16
51 0.11
52 0.1
53 0.11
54 0.1
55 0.1
56 0.1
57 0.1
58 0.09
59 0.08
60 0.07
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.09
68 0.09
69 0.09
70 0.1
71 0.14
72 0.19
73 0.24
74 0.27
75 0.3
76 0.37
77 0.42
78 0.44
79 0.41
80 0.4
81 0.38
82 0.37
83 0.34
84 0.3
85 0.25
86 0.2
87 0.22
88 0.2
89 0.19
90 0.22
91 0.3
92 0.38
93 0.47
94 0.57
95 0.65
96 0.75
97 0.85
98 0.9
99 0.91
100 0.93
101 0.94
102 0.95
103 0.95
104 0.94
105 0.94
106 0.93
107 0.92
108 0.9
109 0.89
110 0.89
111 0.89
112 0.87
113 0.87
114 0.86