Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4KD45

Protein Details
Accession W4KD45    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-22FHSQSRPRVRRHHTDSRLCCVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
KEGG hir:HETIRDRAFT_474390  -  
Amino Acid Sequences MFHSQSRPRVRRHHTDSRLCCVPPGDSKLIPDLLRERYLGRAADAVTAHRSCTLDILVYLRANTPCLLRSAMHLNLASSFCCTRIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.8
4 0.77
5 0.74
6 0.63
7 0.55
8 0.46
9 0.39
10 0.34
11 0.34
12 0.31
13 0.27
14 0.28
15 0.29
16 0.3
17 0.27
18 0.23
19 0.21
20 0.2
21 0.21
22 0.21
23 0.19
24 0.18
25 0.2
26 0.18
27 0.15
28 0.13
29 0.12
30 0.13
31 0.12
32 0.11
33 0.12
34 0.12
35 0.12
36 0.12
37 0.12
38 0.1
39 0.12
40 0.11
41 0.08
42 0.08
43 0.1
44 0.1
45 0.1
46 0.1
47 0.12
48 0.12
49 0.13
50 0.14
51 0.13
52 0.12
53 0.14
54 0.16
55 0.13
56 0.16
57 0.22
58 0.23
59 0.25
60 0.24
61 0.23
62 0.24
63 0.25
64 0.22
65 0.19
66 0.18