Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4K3V7

Protein Details
Accession W4K3V7   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
50-101ATEGAQKKKKEKKPRYRADAFLKARRRDKALKSRNPRQLRKRYKAAERGESCBasic
NLS Segment(s)
PositionSequence
55-94QKKKKEKKPRYRADAFLKARRRDKALKSRNPRQLRKRYKA
Subcellular Location(s) nucl 26
Family & Domain DBs
KEGG hir:HETIRDRAFT_101642  -  
Amino Acid Sequences MEIDDPTVYYAPAYAPSPPPPLPSPYHIALAAAASSASRPAAAAAPPATATEGAQKKKKEKKPRYRADAFLKARRRDKALKSRNPRQLRKRYKAAERGESCGPASGGVERC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.19
4 0.25
5 0.25
6 0.29
7 0.29
8 0.33
9 0.33
10 0.34
11 0.35
12 0.32
13 0.33
14 0.28
15 0.26
16 0.22
17 0.18
18 0.14
19 0.09
20 0.06
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.05
28 0.06
29 0.06
30 0.08
31 0.08
32 0.09
33 0.09
34 0.09
35 0.09
36 0.07
37 0.07
38 0.13
39 0.17
40 0.21
41 0.25
42 0.28
43 0.36
44 0.46
45 0.55
46 0.59
47 0.65
48 0.73
49 0.79
50 0.87
51 0.87
52 0.83
53 0.82
54 0.8
55 0.79
56 0.73
57 0.71
58 0.69
59 0.66
60 0.66
61 0.62
62 0.59
63 0.57
64 0.62
65 0.64
66 0.67
67 0.71
68 0.75
69 0.81
70 0.85
71 0.87
72 0.87
73 0.87
74 0.88
75 0.88
76 0.87
77 0.88
78 0.86
79 0.86
80 0.86
81 0.83
82 0.82
83 0.74
84 0.7
85 0.63
86 0.56
87 0.47
88 0.4
89 0.32
90 0.22
91 0.2