Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1H125

Protein Details
Accession C1H125    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-46VLDGRIGKKGKKKRKKENAKDAEEVDBasic
NLS Segment(s)
PositionSequence
14-38LKIKGAPVLDGRIGKKGKKKRKKEN
97-110ARRKRLDERLKREG
Subcellular Location(s) nucl 21.5, cyto_nucl 13.833, mito_nucl 12.166, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
KEGG pbl:PAAG_04469  -  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MAPADEYVSGGGKLKIKGAPVLDGRIGKKGKKKRKKENAKDAEEVDGSGSIEKDDAMLGAKRVEGDERSRSQSRGVSEGPERVVVGKTEAERKYEEARRKRLDERLKREGFKTHKERVEELNKYLSNLSEHHDMYVCHSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.22
4 0.26
5 0.25
6 0.28
7 0.26
8 0.29
9 0.29
10 0.31
11 0.31
12 0.34
13 0.36
14 0.35
15 0.42
16 0.49
17 0.57
18 0.64
19 0.73
20 0.77
21 0.85
22 0.92
23 0.94
24 0.95
25 0.94
26 0.9
27 0.82
28 0.72
29 0.64
30 0.52
31 0.41
32 0.3
33 0.2
34 0.14
35 0.1
36 0.09
37 0.06
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.05
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.07
50 0.08
51 0.09
52 0.12
53 0.16
54 0.18
55 0.24
56 0.25
57 0.25
58 0.26
59 0.27
60 0.25
61 0.24
62 0.22
63 0.2
64 0.2
65 0.21
66 0.2
67 0.17
68 0.16
69 0.13
70 0.13
71 0.1
72 0.1
73 0.1
74 0.11
75 0.18
76 0.19
77 0.2
78 0.21
79 0.24
80 0.3
81 0.35
82 0.43
83 0.45
84 0.53
85 0.58
86 0.62
87 0.65
88 0.67
89 0.7
90 0.72
91 0.72
92 0.73
93 0.73
94 0.7
95 0.67
96 0.66
97 0.62
98 0.62
99 0.61
100 0.6
101 0.59
102 0.6
103 0.61
104 0.61
105 0.64
106 0.58
107 0.53
108 0.53
109 0.47
110 0.45
111 0.43
112 0.35
113 0.28
114 0.25
115 0.27
116 0.24
117 0.24
118 0.24
119 0.25
120 0.23