Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JUK1

Protein Details
Accession W4JUK1    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
30-54SSPYGRTHVWKRRPNKLPNPVVPQFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 11.5, cyto 3.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG hir:HETIRDRAFT_430081  -  
Amino Acid Sequences MSFITAFSKPSTSALTPLRALKTQTRSISSSPYGRTHVWKRRPNKLPNPVVPQFPQRVIRSDGSTFTHWTTSPRSVIRLTRDVTNNPMWNVSSLTSEDAEEESSTTGRLGRFNRRFVEVGARGSGGQEVDWIGEAEVQAPEGSAGKGKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.31
4 0.35
5 0.36
6 0.33
7 0.36
8 0.38
9 0.4
10 0.44
11 0.45
12 0.45
13 0.45
14 0.44
15 0.47
16 0.43
17 0.41
18 0.38
19 0.37
20 0.36
21 0.35
22 0.41
23 0.45
24 0.51
25 0.56
26 0.6
27 0.64
28 0.71
29 0.79
30 0.81
31 0.82
32 0.82
33 0.81
34 0.8
35 0.81
36 0.73
37 0.67
38 0.59
39 0.53
40 0.46
41 0.4
42 0.39
43 0.31
44 0.33
45 0.33
46 0.33
47 0.31
48 0.29
49 0.28
50 0.25
51 0.25
52 0.23
53 0.19
54 0.19
55 0.16
56 0.17
57 0.18
58 0.18
59 0.19
60 0.18
61 0.19
62 0.21
63 0.24
64 0.26
65 0.27
66 0.26
67 0.27
68 0.29
69 0.28
70 0.3
71 0.32
72 0.29
73 0.24
74 0.24
75 0.2
76 0.18
77 0.18
78 0.14
79 0.11
80 0.1
81 0.11
82 0.11
83 0.1
84 0.1
85 0.09
86 0.09
87 0.08
88 0.08
89 0.07
90 0.07
91 0.07
92 0.07
93 0.08
94 0.09
95 0.14
96 0.18
97 0.28
98 0.34
99 0.4
100 0.42
101 0.44
102 0.44
103 0.41
104 0.46
105 0.39
106 0.35
107 0.31
108 0.29
109 0.25
110 0.24
111 0.23
112 0.14
113 0.1
114 0.08
115 0.07
116 0.07
117 0.08
118 0.08
119 0.07
120 0.08
121 0.08
122 0.08
123 0.08
124 0.08
125 0.07
126 0.07
127 0.08
128 0.08
129 0.09
130 0.13