Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JN17

Protein Details
Accession W4JN17    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
18-38GPVRTKPKRATPTPYNRSPKLHydrophilic
NLS Segment(s)
PositionSequence
248-269RGRGRGRGRRGFVNGNGRRGKG
Subcellular Location(s) mito 14, cyto 7, cyto_nucl 7, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG hir:HETIRDRAFT_482766  -  
CDD cd00590  RRM_SF  
Amino Acid Sequences MASLLERMNIDVPATSVGPVRTKPKRATPTPYNRSPKLPRGDVNGTWEHDLYQTDGGNGKSLSARLTSPGGAPKMNFGFAEKALQEATGVRGDRGELSIRGASSRGNVVEVTGLVSGTTAEDVEAIFKRCGPITQSSAKPTAAGGVSVRLTFKHEKDAKTAETQFDKQVADGKTLHVKVIGGVNASLTGRLGVGVQDGSVDVLLGESTGSSKMRSDDILSDADARARAHVLVAPPGADPKDYTQQHWRGRGRGRGRRGFVNGNGRRGKGEGRMDVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.13
4 0.15
5 0.18
6 0.21
7 0.29
8 0.35
9 0.43
10 0.49
11 0.56
12 0.64
13 0.68
14 0.74
15 0.75
16 0.78
17 0.79
18 0.83
19 0.81
20 0.75
21 0.77
22 0.75
23 0.73
24 0.71
25 0.68
26 0.62
27 0.62
28 0.65
29 0.58
30 0.56
31 0.52
32 0.45
33 0.4
34 0.37
35 0.29
36 0.24
37 0.22
38 0.18
39 0.16
40 0.14
41 0.13
42 0.16
43 0.15
44 0.16
45 0.16
46 0.14
47 0.13
48 0.13
49 0.14
50 0.12
51 0.13
52 0.12
53 0.14
54 0.14
55 0.15
56 0.19
57 0.2
58 0.2
59 0.19
60 0.22
61 0.21
62 0.22
63 0.2
64 0.17
65 0.18
66 0.17
67 0.2
68 0.15
69 0.15
70 0.14
71 0.13
72 0.12
73 0.09
74 0.11
75 0.11
76 0.12
77 0.11
78 0.11
79 0.11
80 0.12
81 0.13
82 0.13
83 0.09
84 0.11
85 0.13
86 0.13
87 0.13
88 0.12
89 0.11
90 0.1
91 0.12
92 0.09
93 0.09
94 0.09
95 0.08
96 0.09
97 0.08
98 0.08
99 0.06
100 0.06
101 0.05
102 0.05
103 0.04
104 0.04
105 0.04
106 0.03
107 0.03
108 0.03
109 0.03
110 0.05
111 0.06
112 0.08
113 0.08
114 0.09
115 0.1
116 0.1
117 0.11
118 0.12
119 0.14
120 0.17
121 0.22
122 0.24
123 0.26
124 0.27
125 0.26
126 0.24
127 0.2
128 0.17
129 0.12
130 0.1
131 0.08
132 0.08
133 0.08
134 0.09
135 0.09
136 0.07
137 0.11
138 0.14
139 0.15
140 0.23
141 0.27
142 0.28
143 0.33
144 0.36
145 0.34
146 0.36
147 0.37
148 0.31
149 0.3
150 0.3
151 0.27
152 0.26
153 0.24
154 0.19
155 0.24
156 0.21
157 0.2
158 0.19
159 0.19
160 0.23
161 0.23
162 0.23
163 0.17
164 0.16
165 0.14
166 0.17
167 0.16
168 0.1
169 0.1
170 0.1
171 0.1
172 0.1
173 0.09
174 0.06
175 0.05
176 0.05
177 0.05
178 0.05
179 0.04
180 0.05
181 0.05
182 0.05
183 0.05
184 0.05
185 0.05
186 0.04
187 0.04
188 0.03
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.04
195 0.05
196 0.06
197 0.07
198 0.08
199 0.1
200 0.11
201 0.13
202 0.14
203 0.15
204 0.17
205 0.18
206 0.18
207 0.18
208 0.17
209 0.17
210 0.17
211 0.14
212 0.13
213 0.13
214 0.12
215 0.11
216 0.13
217 0.13
218 0.15
219 0.15
220 0.15
221 0.14
222 0.17
223 0.17
224 0.15
225 0.15
226 0.17
227 0.26
228 0.27
229 0.32
230 0.39
231 0.48
232 0.55
233 0.63
234 0.63
235 0.61
236 0.68
237 0.73
238 0.74
239 0.74
240 0.77
241 0.77
242 0.76
243 0.76
244 0.74
245 0.72
246 0.69
247 0.7
248 0.66
249 0.66
250 0.66
251 0.59
252 0.55
253 0.5
254 0.46
255 0.44
256 0.46