Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CL77

Protein Details
Accession Q6CL77    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MIKRPSNSKKKANLRRLTGALHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, mito_nucl 13.5, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018465  Scm3/HJURP  
Gene Ontology GO:0005634  C:nucleus  
GO:0042393  F:histone binding  
KEGG kla:KLLA0_F05115g  -  
Pfam View protein in Pfam  
PF10384  Scm3  
Amino Acid Sequences MIKRPSNSKKKANLRRLTGALRDLLGEEEPKKEENLKQITRDGVVYIMSKENRLIPKLSDEEVMERHKKADENMKRVWSQIIQKYESIDNQGDVIDLQTGEVIEDNGHLRNLSNEKSVLHSSLPDGGSVSYKSVLNDIMDIKDSSYNSSVWQDHETNDSETGSESESGLEADGLDEGSGSEADNSNEVYMKKLRPNPESN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.79
4 0.74
5 0.67
6 0.59
7 0.5
8 0.41
9 0.34
10 0.27
11 0.22
12 0.18
13 0.17
14 0.15
15 0.16
16 0.17
17 0.18
18 0.19
19 0.22
20 0.25
21 0.3
22 0.39
23 0.4
24 0.42
25 0.44
26 0.44
27 0.41
28 0.38
29 0.29
30 0.2
31 0.17
32 0.15
33 0.13
34 0.17
35 0.16
36 0.16
37 0.17
38 0.22
39 0.24
40 0.25
41 0.24
42 0.2
43 0.26
44 0.28
45 0.28
46 0.24
47 0.21
48 0.22
49 0.24
50 0.28
51 0.25
52 0.23
53 0.23
54 0.23
55 0.23
56 0.25
57 0.32
58 0.34
59 0.38
60 0.42
61 0.45
62 0.43
63 0.42
64 0.41
65 0.34
66 0.32
67 0.32
68 0.33
69 0.3
70 0.3
71 0.32
72 0.31
73 0.28
74 0.24
75 0.19
76 0.14
77 0.13
78 0.12
79 0.1
80 0.08
81 0.08
82 0.05
83 0.04
84 0.04
85 0.04
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.04
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.08
98 0.11
99 0.12
100 0.13
101 0.13
102 0.13
103 0.17
104 0.18
105 0.16
106 0.14
107 0.13
108 0.12
109 0.16
110 0.15
111 0.12
112 0.12
113 0.11
114 0.12
115 0.12
116 0.12
117 0.09
118 0.09
119 0.1
120 0.1
121 0.11
122 0.1
123 0.11
124 0.11
125 0.11
126 0.12
127 0.12
128 0.11
129 0.13
130 0.13
131 0.14
132 0.15
133 0.14
134 0.14
135 0.18
136 0.18
137 0.18
138 0.22
139 0.21
140 0.2
141 0.24
142 0.25
143 0.22
144 0.22
145 0.2
146 0.16
147 0.16
148 0.15
149 0.13
150 0.11
151 0.09
152 0.09
153 0.09
154 0.09
155 0.08
156 0.07
157 0.05
158 0.05
159 0.05
160 0.05
161 0.04
162 0.04
163 0.04
164 0.05
165 0.05
166 0.05
167 0.06
168 0.08
169 0.09
170 0.1
171 0.11
172 0.1
173 0.14
174 0.14
175 0.17
176 0.21
177 0.26
178 0.34
179 0.4
180 0.48