Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4KB96

Protein Details
Accession W4KB96    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
220-246VQTRDSIRKVLKKRKGKKGGLFREEIGBasic
NLS Segment(s)
PositionSequence
227-238RKVLKKRKGKKG
Subcellular Location(s) mito 7, extr 7, cyto 5.5, pero 5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002495  Glyco_trans_8  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016757  F:glycosyltransferase activity  
KEGG hir:HETIRDRAFT_146131  -  
Pfam View protein in Pfam  
PF01501  Glyco_transf_8  
Amino Acid Sequences MYTDAFAFPVATLGHSLALTNTTARKILMYLPNKVSAEALCIARAGGWELNPVPFIQPPHGGAGTGYRFGDQYTKLNLWGLDQIGVKAAVYLDADTLVRRPFEELFALPFDFAAVPDVFVADRRGGFKLGFNAGVLFLRPSNATLWQMLDNLDRAVFPPFEAEQAFLNVFFAADAVRLPYVYNGNLAIKLRNPAMWTAIRDELRVVHYTSVKPFDVFNGVQTRDSIRKVLKKRKGKKGGLFREEIGWWEDAWTELLTVPALHECFESEAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.09
5 0.1
6 0.1
7 0.12
8 0.13
9 0.14
10 0.15
11 0.15
12 0.15
13 0.15
14 0.22
15 0.29
16 0.31
17 0.36
18 0.38
19 0.45
20 0.44
21 0.43
22 0.37
23 0.28
24 0.27
25 0.24
26 0.21
27 0.15
28 0.14
29 0.14
30 0.13
31 0.13
32 0.12
33 0.1
34 0.1
35 0.12
36 0.13
37 0.14
38 0.14
39 0.14
40 0.13
41 0.14
42 0.15
43 0.15
44 0.17
45 0.18
46 0.21
47 0.21
48 0.19
49 0.17
50 0.21
51 0.2
52 0.19
53 0.18
54 0.15
55 0.15
56 0.15
57 0.19
58 0.15
59 0.17
60 0.2
61 0.2
62 0.2
63 0.22
64 0.21
65 0.19
66 0.19
67 0.16
68 0.14
69 0.13
70 0.13
71 0.12
72 0.12
73 0.1
74 0.08
75 0.08
76 0.06
77 0.06
78 0.06
79 0.05
80 0.06
81 0.06
82 0.06
83 0.08
84 0.08
85 0.08
86 0.08
87 0.1
88 0.1
89 0.11
90 0.13
91 0.12
92 0.13
93 0.14
94 0.14
95 0.12
96 0.11
97 0.1
98 0.08
99 0.07
100 0.08
101 0.06
102 0.06
103 0.06
104 0.07
105 0.06
106 0.07
107 0.08
108 0.06
109 0.07
110 0.08
111 0.09
112 0.1
113 0.1
114 0.11
115 0.13
116 0.13
117 0.13
118 0.11
119 0.11
120 0.1
121 0.1
122 0.08
123 0.06
124 0.05
125 0.05
126 0.05
127 0.06
128 0.06
129 0.08
130 0.09
131 0.09
132 0.1
133 0.1
134 0.11
135 0.11
136 0.11
137 0.1
138 0.09
139 0.08
140 0.07
141 0.07
142 0.09
143 0.08
144 0.07
145 0.09
146 0.09
147 0.1
148 0.1
149 0.1
150 0.09
151 0.1
152 0.1
153 0.08
154 0.08
155 0.07
156 0.06
157 0.05
158 0.05
159 0.03
160 0.03
161 0.04
162 0.04
163 0.04
164 0.05
165 0.05
166 0.07
167 0.08
168 0.09
169 0.09
170 0.1
171 0.11
172 0.13
173 0.14
174 0.13
175 0.13
176 0.15
177 0.15
178 0.15
179 0.16
180 0.14
181 0.18
182 0.2
183 0.2
184 0.21
185 0.26
186 0.25
187 0.24
188 0.24
189 0.22
190 0.22
191 0.22
192 0.19
193 0.17
194 0.2
195 0.22
196 0.25
197 0.27
198 0.25
199 0.23
200 0.22
201 0.21
202 0.24
203 0.22
204 0.23
205 0.25
206 0.26
207 0.26
208 0.27
209 0.3
210 0.28
211 0.3
212 0.3
213 0.31
214 0.39
215 0.48
216 0.58
217 0.64
218 0.7
219 0.79
220 0.85
221 0.89
222 0.89
223 0.89
224 0.9
225 0.91
226 0.87
227 0.8
228 0.7
229 0.63
230 0.54
231 0.46
232 0.37
233 0.27
234 0.2
235 0.16
236 0.15
237 0.12
238 0.13
239 0.11
240 0.09
241 0.09
242 0.1
243 0.09
244 0.09
245 0.09
246 0.12
247 0.12
248 0.12
249 0.12
250 0.13