Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4JXM0

Protein Details
Accession W4JXM0    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
2-24MSPPGNATRPKRKQVKMACTNCAHydrophilic
48-78CVDGVRKERKKGIKRGPYKRKNKLGPPENPABasic
209-231GASGAEKKKRKRGKAPEEQSATQHydrophilic
NLS Segment(s)
PositionSequence
53-71RKERKKGIKRGPYKRKNKL
214-240EKKKRKRGKAPEEQSATQEKAPKKGKR
Subcellular Location(s) mito 24, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG hir:HETIRDRAFT_411134  -  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MMSPPGNATRPKRKQVKMACTNCAAACKRCDEARPCERCVKYGIADSCVDGVRKERKKGIKRGPYKRKNKLGPPENPAYPGYSNGESQWAPEQTNGGPSNTPAMLPPPQFMPAPEGYYPYYYPPHPGYMSAQHDPHANGDPGANAPPPPHPTFYPLHPAYPPMPIYSSSYMLQPGQQGQGQGQVVEPAEVAKNGHGAVRGASDSGVAVGASGAEKKKRKRGKAPEEQSATQEKAPKKGKRADGTEGNGSVEAERRDEMLTVGTPATAGASSEGGDSSPVVCSAVLSGTDAHPPVIAAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.85
4 0.84
5 0.82
6 0.78
7 0.71
8 0.68
9 0.59
10 0.56
11 0.49
12 0.43
13 0.39
14 0.38
15 0.38
16 0.38
17 0.45
18 0.44
19 0.5
20 0.55
21 0.57
22 0.58
23 0.64
24 0.61
25 0.56
26 0.53
27 0.48
28 0.41
29 0.43
30 0.4
31 0.34
32 0.34
33 0.32
34 0.3
35 0.27
36 0.24
37 0.16
38 0.21
39 0.27
40 0.34
41 0.38
42 0.45
43 0.53
44 0.63
45 0.73
46 0.77
47 0.78
48 0.82
49 0.88
50 0.91
51 0.91
52 0.92
53 0.92
54 0.91
55 0.89
56 0.88
57 0.88
58 0.86
59 0.83
60 0.8
61 0.76
62 0.66
63 0.6
64 0.51
65 0.44
66 0.34
67 0.29
68 0.26
69 0.21
70 0.2
71 0.18
72 0.21
73 0.17
74 0.18
75 0.2
76 0.18
77 0.17
78 0.17
79 0.18
80 0.15
81 0.22
82 0.21
83 0.17
84 0.16
85 0.16
86 0.19
87 0.17
88 0.16
89 0.1
90 0.12
91 0.15
92 0.16
93 0.16
94 0.15
95 0.16
96 0.16
97 0.17
98 0.18
99 0.15
100 0.17
101 0.17
102 0.18
103 0.17
104 0.19
105 0.19
106 0.17
107 0.17
108 0.15
109 0.18
110 0.17
111 0.19
112 0.18
113 0.19
114 0.19
115 0.23
116 0.28
117 0.27
118 0.26
119 0.23
120 0.25
121 0.24
122 0.23
123 0.19
124 0.14
125 0.12
126 0.12
127 0.11
128 0.1
129 0.11
130 0.09
131 0.07
132 0.08
133 0.1
134 0.14
135 0.15
136 0.17
137 0.16
138 0.2
139 0.22
140 0.23
141 0.29
142 0.25
143 0.25
144 0.23
145 0.25
146 0.22
147 0.24
148 0.22
149 0.14
150 0.14
151 0.14
152 0.17
153 0.17
154 0.18
155 0.16
156 0.16
157 0.16
158 0.15
159 0.15
160 0.13
161 0.12
162 0.12
163 0.12
164 0.12
165 0.11
166 0.15
167 0.14
168 0.13
169 0.12
170 0.11
171 0.1
172 0.1
173 0.1
174 0.06
175 0.06
176 0.07
177 0.07
178 0.06
179 0.07
180 0.07
181 0.08
182 0.08
183 0.08
184 0.08
185 0.09
186 0.09
187 0.08
188 0.08
189 0.07
190 0.06
191 0.06
192 0.06
193 0.04
194 0.03
195 0.03
196 0.03
197 0.04
198 0.06
199 0.08
200 0.15
201 0.21
202 0.28
203 0.38
204 0.47
205 0.56
206 0.65
207 0.74
208 0.79
209 0.84
210 0.86
211 0.85
212 0.83
213 0.75
214 0.67
215 0.61
216 0.52
217 0.43
218 0.43
219 0.35
220 0.38
221 0.46
222 0.48
223 0.51
224 0.58
225 0.65
226 0.66
227 0.7
228 0.69
229 0.68
230 0.66
231 0.63
232 0.55
233 0.47
234 0.38
235 0.33
236 0.25
237 0.21
238 0.17
239 0.14
240 0.14
241 0.14
242 0.15
243 0.15
244 0.14
245 0.13
246 0.13
247 0.13
248 0.12
249 0.11
250 0.1
251 0.09
252 0.1
253 0.07
254 0.07
255 0.06
256 0.07
257 0.07
258 0.08
259 0.08
260 0.07
261 0.08
262 0.08
263 0.07
264 0.08
265 0.07
266 0.08
267 0.07
268 0.07
269 0.08
270 0.09
271 0.09
272 0.09
273 0.11
274 0.11
275 0.15
276 0.16
277 0.15
278 0.13