Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4KRJ3

Protein Details
Accession W4KRJ3   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
510-537VPQWILKLPKPSKLKRRQMGKVKRAEAVHydrophilic
NLS Segment(s)
PositionSequence
517-564LPKPSKLKRRQMGKVKRAEAVNPARKIGRNEAIKKRDMIAGSKRRKEK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044764  DDX52/Rok1_DEADc  
IPR011545  DEAD/DEAH_box_helicase_dom  
IPR014001  Helicase_ATP-bd  
IPR001650  Helicase_C  
IPR027417  P-loop_NTPase  
IPR000629  RNA-helicase_DEAD-box_CS  
IPR014014  RNA_helicase_DEAD_Q_motif  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016787  F:hydrolase activity  
GO:0003676  F:nucleic acid binding  
GO:0003724  F:RNA helicase activity  
GO:0030490  P:maturation of SSU-rRNA  
KEGG hir:HETIRDRAFT_306455  -  
Pfam View protein in Pfam  
PF00270  DEAD  
PF00271  Helicase_C  
PROSITE View protein in PROSITE  
PS00039  DEAD_ATP_HELICASE  
PS51192  HELICASE_ATP_BIND_1  
PS51194  HELICASE_CTER  
PS51195  Q_MOTIF  
CDD cd17957  DEADc_DDX52  
cd18787  SF2_C_DEAD  
Amino Acid Sequences MEAFRLLSRGGVQFNKQRFQNEIDLFNKTRPRSTHEKEAAKDLDAELPADLDFFKYAKTGAPKRKASDLSVAAEHGEVSERKRRKLSEGADEEESEESEGERTPAEGPTPSNPIQRHKVTAKGSNVPNSAETFEELKQRYNLPPHLMANLKQYEYKHPTGIQSHGIPILLESRDLAAISPTGTGKTLSYLLPVMASLAAPISSSKSENGKGVRAVILAPTRELAHQIHNECMKLAQGRKWRIVLFSKATAATLADPNVRNRVDIIISTPLRLVSSLQSGNLELENVRHLILDEADRMLDAEFLSQVQEVVSSCTHENVQKAVFSATLPANAEKVAMDMLRNPIRVVVGLKDTPLPLIAQSLTYVSDDPSKLPTILTYLNQPYNPPVLVFTSSQPRATSLAEELVLNGVPNVDCLHAGMSKKEREDAVSRMRRGESWIMVSTEVMARGMDFKGVREVINYDFPQSVQSYIHRIGRTGRAGREGKAITYFTNDDAPYLKSIANVLLQSGSTVPQWILKLPKPSKLKRRQMGKVKRAEAVNPARKIGRNEAIKKRDMIAGSKRRKEKVTVEKSDVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.5
4 0.5
5 0.49
6 0.51
7 0.54
8 0.5
9 0.51
10 0.47
11 0.51
12 0.49
13 0.51
14 0.53
15 0.45
16 0.47
17 0.43
18 0.47
19 0.51
20 0.56
21 0.61
22 0.63
23 0.7
24 0.65
25 0.71
26 0.66
27 0.57
28 0.51
29 0.41
30 0.36
31 0.28
32 0.27
33 0.18
34 0.16
35 0.14
36 0.13
37 0.12
38 0.08
39 0.08
40 0.08
41 0.08
42 0.08
43 0.09
44 0.14
45 0.23
46 0.32
47 0.41
48 0.51
49 0.57
50 0.6
51 0.69
52 0.67
53 0.62
54 0.61
55 0.56
56 0.5
57 0.44
58 0.41
59 0.32
60 0.29
61 0.24
62 0.15
63 0.15
64 0.12
65 0.15
66 0.24
67 0.28
68 0.34
69 0.4
70 0.43
71 0.46
72 0.55
73 0.57
74 0.58
75 0.6
76 0.59
77 0.55
78 0.52
79 0.47
80 0.37
81 0.31
82 0.21
83 0.14
84 0.1
85 0.09
86 0.09
87 0.08
88 0.07
89 0.08
90 0.09
91 0.1
92 0.11
93 0.12
94 0.14
95 0.17
96 0.24
97 0.25
98 0.3
99 0.33
100 0.38
101 0.44
102 0.45
103 0.49
104 0.46
105 0.51
106 0.5
107 0.55
108 0.54
109 0.54
110 0.55
111 0.55
112 0.53
113 0.46
114 0.42
115 0.36
116 0.31
117 0.24
118 0.21
119 0.18
120 0.18
121 0.24
122 0.23
123 0.24
124 0.25
125 0.28
126 0.31
127 0.35
128 0.38
129 0.36
130 0.39
131 0.37
132 0.39
133 0.38
134 0.35
135 0.36
136 0.34
137 0.3
138 0.29
139 0.3
140 0.35
141 0.39
142 0.4
143 0.35
144 0.34
145 0.37
146 0.38
147 0.39
148 0.34
149 0.28
150 0.27
151 0.24
152 0.22
153 0.17
154 0.15
155 0.16
156 0.12
157 0.1
158 0.09
159 0.09
160 0.09
161 0.1
162 0.09
163 0.06
164 0.06
165 0.06
166 0.07
167 0.07
168 0.07
169 0.08
170 0.08
171 0.08
172 0.09
173 0.1
174 0.09
175 0.1
176 0.1
177 0.1
178 0.09
179 0.09
180 0.07
181 0.06
182 0.06
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.06
189 0.07
190 0.08
191 0.1
192 0.14
193 0.15
194 0.19
195 0.21
196 0.21
197 0.21
198 0.21
199 0.2
200 0.17
201 0.16
202 0.15
203 0.16
204 0.13
205 0.13
206 0.12
207 0.12
208 0.12
209 0.14
210 0.12
211 0.15
212 0.19
213 0.2
214 0.24
215 0.24
216 0.24
217 0.22
218 0.21
219 0.17
220 0.17
221 0.18
222 0.2
223 0.27
224 0.31
225 0.34
226 0.37
227 0.36
228 0.36
229 0.38
230 0.37
231 0.32
232 0.29
233 0.28
234 0.25
235 0.24
236 0.2
237 0.16
238 0.12
239 0.1
240 0.1
241 0.12
242 0.13
243 0.14
244 0.19
245 0.18
246 0.17
247 0.16
248 0.17
249 0.14
250 0.13
251 0.14
252 0.15
253 0.15
254 0.15
255 0.15
256 0.14
257 0.13
258 0.13
259 0.12
260 0.07
261 0.1
262 0.1
263 0.1
264 0.11
265 0.11
266 0.11
267 0.1
268 0.09
269 0.05
270 0.06
271 0.06
272 0.06
273 0.06
274 0.05
275 0.06
276 0.06
277 0.06
278 0.07
279 0.06
280 0.06
281 0.06
282 0.06
283 0.06
284 0.06
285 0.05
286 0.04
287 0.04
288 0.04
289 0.04
290 0.05
291 0.04
292 0.04
293 0.04
294 0.04
295 0.04
296 0.06
297 0.06
298 0.08
299 0.08
300 0.09
301 0.1
302 0.11
303 0.12
304 0.12
305 0.13
306 0.11
307 0.12
308 0.12
309 0.11
310 0.09
311 0.11
312 0.09
313 0.1
314 0.11
315 0.1
316 0.1
317 0.1
318 0.1
319 0.07
320 0.07
321 0.06
322 0.06
323 0.05
324 0.07
325 0.13
326 0.15
327 0.15
328 0.15
329 0.15
330 0.15
331 0.15
332 0.15
333 0.11
334 0.12
335 0.12
336 0.13
337 0.13
338 0.13
339 0.12
340 0.12
341 0.1
342 0.06
343 0.08
344 0.07
345 0.06
346 0.07
347 0.07
348 0.08
349 0.08
350 0.08
351 0.07
352 0.11
353 0.11
354 0.12
355 0.14
356 0.14
357 0.14
358 0.13
359 0.13
360 0.12
361 0.14
362 0.14
363 0.16
364 0.19
365 0.22
366 0.22
367 0.22
368 0.22
369 0.22
370 0.21
371 0.16
372 0.14
373 0.13
374 0.15
375 0.15
376 0.16
377 0.21
378 0.23
379 0.24
380 0.23
381 0.22
382 0.22
383 0.22
384 0.21
385 0.14
386 0.15
387 0.14
388 0.13
389 0.12
390 0.11
391 0.1
392 0.08
393 0.06
394 0.06
395 0.05
396 0.05
397 0.06
398 0.06
399 0.06
400 0.06
401 0.08
402 0.1
403 0.11
404 0.16
405 0.21
406 0.24
407 0.25
408 0.27
409 0.26
410 0.28
411 0.31
412 0.33
413 0.38
414 0.42
415 0.43
416 0.44
417 0.44
418 0.4
419 0.41
420 0.4
421 0.32
422 0.28
423 0.29
424 0.26
425 0.25
426 0.25
427 0.21
428 0.17
429 0.15
430 0.11
431 0.08
432 0.07
433 0.09
434 0.09
435 0.12
436 0.11
437 0.11
438 0.16
439 0.17
440 0.17
441 0.17
442 0.19
443 0.18
444 0.26
445 0.25
446 0.22
447 0.22
448 0.22
449 0.23
450 0.21
451 0.2
452 0.15
453 0.16
454 0.2
455 0.24
456 0.29
457 0.27
458 0.28
459 0.31
460 0.36
461 0.42
462 0.42
463 0.41
464 0.44
465 0.45
466 0.46
467 0.49
468 0.42
469 0.36
470 0.34
471 0.33
472 0.24
473 0.27
474 0.27
475 0.2
476 0.25
477 0.23
478 0.2
479 0.21
480 0.22
481 0.19
482 0.19
483 0.18
484 0.13
485 0.15
486 0.16
487 0.17
488 0.15
489 0.14
490 0.14
491 0.13
492 0.13
493 0.13
494 0.12
495 0.09
496 0.1
497 0.1
498 0.13
499 0.14
500 0.18
501 0.24
502 0.27
503 0.38
504 0.4
505 0.48
506 0.55
507 0.63
508 0.7
509 0.75
510 0.81
511 0.79
512 0.86
513 0.88
514 0.89
515 0.91
516 0.89
517 0.89
518 0.82
519 0.79
520 0.71
521 0.64
522 0.63
523 0.62
524 0.62
525 0.54
526 0.53
527 0.52
528 0.54
529 0.56
530 0.55
531 0.53
532 0.54
533 0.61
534 0.68
535 0.7
536 0.7
537 0.67
538 0.61
539 0.57
540 0.5
541 0.49
542 0.49
543 0.53
544 0.59
545 0.65
546 0.7
547 0.71
548 0.72
549 0.72
550 0.72
551 0.72
552 0.73
553 0.72